KEGG   Cyanothece sp. PCC 7425: Cyan7425_0946Help
Entry
Cyan7425_0946     CDS       T00836                                 

Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase, type I
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
cyn  Cyanothece sp. PCC 7425
Pathway
cyn00010  Glycolysis / Gluconeogenesis
cyn00710  Carbon fixation in photosynthetic organisms
cyn01100  Metabolic pathways
cyn01110  Biosynthesis of secondary metabolites
cyn01120  Microbial metabolism in diverse environments
cyn01130  Biosynthesis of antibiotics
cyn01200  Carbon metabolism
cyn01230  Biosynthesis of amino acids
Module
cyn_M00002  Glycolysis, core module involving three-carbon compounds
cyn_M00165  Reductive pentose phosphate cycle (Calvin cycle)
cyn_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
cyn_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:cyn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cyan7425_0946
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Cyan7425_0946
Enzymes [BR:cyn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     Cyan7425_0946
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C Gp_dh_N GFO_IDH_MocA NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ACL43332
JGI: Cyan74250946
UniProt: B8HX29
Position
complement(759456..760463)
Genome map
AA seq 335 aa AA seqDB search
MIRVAINGFGRIGRNFMRCWLQRQAESKLEIVAINDTSDPHTNAHLLKYDSMLGISNATI
SSDDNSIIANGNVVKCVSDRNPENLPWAAWDIDLVIESTGVFISDEGASKHLNAGAKKVL
ITAPGKGKVGTYVVGVNHHTYNPEDKILSNASCTTNCLAPIVKVLHESFGIVQGMMTTTH
SYTGDQRLLDASHRDLRRARAAGVNIVPTSTGAAKAVGLVIPELKGKLNGIALRVPTPNV
SIVDFVAQVEKPTIAEQVNEVLKAAAEGSMKGIIHYSDLELVSSDYRGHDASSIVDASLT
MVMGGNMIKVVAWYDNEWGYSQRVLDLAEYVAEKW
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
gtgattagagtagcaattaacggatttggcaggattggacgcaattttatgcgctgctgg
ctgcaacggcaggccgagagtaagctggagattgtcgccatcaatgacacttctgatccc
cacaccaatgcccatctgctcaagtacgactctatgctgggcatctccaacgctaccatt
agctcagatgataattccattattgccaatggcaatgtggtcaagtgcgtgtccgatcgc
aatccagaaaacctgccctgggcagcctgggacattgacctggtgattgaatccactggg
gtattcatctccgatgaaggagcctctaaacacctcaacgccggagctaaaaaggtttta
atcaccgctcccggtaagggcaaagtgggtacctacgtcgtcggggttaaccaccacacc
tacaatcctgaagataaaattctcagcaatgccagttgcacaaccaactgtctcgctccg
atcgttaaagtcctgcacgaaagctttggcattgttcaggggatgatgaccaccacccac
agctataccggagatcaacggcttctggatgctagccaccgggatttacgtcgggccagg
gctgctggtgtcaatattgtccccacctccacgggtgcagcgaaggcggttggcttggtg
attccagagttgaaaggcaaattaaacgggattgccctgcgggttcctacccccaacgtg
tcgatcgttgactttgtggctcaggtcgaaaaaccgacgatcgccgaacaggtgaacgaa
gtcctcaaagccgccgctgaagggtcgatgaaagggatcattcactacagtgatctggaa
ctcgtctccagcgattaccgcggtcatgatgcctcctcgatcgtcgatgcctctctgacc
atggtcatgggcgggaatatgattaaagtcgttgcctggtacgataacgaatggggctac
agccagcgggttttagatctggcggaatacgtagccgagaagtggtag

DBGET integrated database retrieval system