KEGG   Cyanothece sp. PCC 7425: Cyan7425_0946Help
Entry
Cyan7425_0946     CDS       T00836                                 

Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase, type I
  KO
K00150  
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
cyn  Cyanothece sp. PCC 7425
Pathway
Glycolysis / Gluconeogenesis
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:cyn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cyan7425_0946
   01230 Biosynthesis of amino acids
    Cyan7425_0946
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cyan7425_0946
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Cyan7425_0946
Enzymes [BR:cyn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     Cyan7425_0946
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(759456..760463)
Genome map
AA seq 335 aa AA seqDB search
MIRVAINGFGRIGRNFMRCWLQRQAESKLEIVAINDTSDPHTNAHLLKYDSMLGISNATI
SSDDNSIIANGNVVKCVSDRNPENLPWAAWDIDLVIESTGVFISDEGASKHLNAGAKKVL
ITAPGKGKVGTYVVGVNHHTYNPEDKILSNASCTTNCLAPIVKVLHESFGIVQGMMTTTH
SYTGDQRLLDASHRDLRRARAAGVNIVPTSTGAAKAVGLVIPELKGKLNGIALRVPTPNV
SIVDFVAQVEKPTIAEQVNEVLKAAAEGSMKGIIHYSDLELVSSDYRGHDASSIVDASLT
MVMGGNMIKVVAWYDNEWGYSQRVLDLAEYVAEKW
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
gtgattagagtagcaattaacggatttggcaggattggacgcaattttatgcgctgctgg
ctgcaacggcaggccgagagtaagctggagattgtcgccatcaatgacacttctgatccc
cacaccaatgcccatctgctcaagtacgactctatgctgggcatctccaacgctaccatt
agctcagatgataattccattattgccaatggcaatgtggtcaagtgcgtgtccgatcgc
aatccagaaaacctgccctgggcagcctgggacattgacctggtgattgaatccactggg
gtattcatctccgatgaaggagcctctaaacacctcaacgccggagctaaaaaggtttta
atcaccgctcccggtaagggcaaagtgggtacctacgtcgtcggggttaaccaccacacc
tacaatcctgaagataaaattctcagcaatgccagttgcacaaccaactgtctcgctccg
atcgttaaagtcctgcacgaaagctttggcattgttcaggggatgatgaccaccacccac
agctataccggagatcaacggcttctggatgctagccaccgggatttacgtcgggccagg
gctgctggtgtcaatattgtccccacctccacgggtgcagcgaaggcggttggcttggtg
attccagagttgaaaggcaaattaaacgggattgccctgcgggttcctacccccaacgtg
tcgatcgttgactttgtggctcaggtcgaaaaaccgacgatcgccgaacaggtgaacgaa
gtcctcaaagccgccgctgaagggtcgatgaaagggatcattcactacagtgatctggaa
ctcgtctccagcgattaccgcggtcatgatgcctcctcgatcgtcgatgcctctctgacc
atggtcatgggcgggaatatgattaaagtcgttgcctggtacgataacgaatggggctac
agccagcgggttttagatctggcggaatacgtagccgagaagtggtag

DBGET integrated database retrieval system