KEGG   Cyanothece sp. PCC 7425: Cyan7425_1055Help
Entry
Cyan7425_1055     CDS       T00836                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cyn  Cyanothece sp. PCC 7425
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cyn00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(869308..870810)
Genome map
AA seq 500 aa AA seqDB search
MPFSRSSGILLHPTSLPGDYGIGDLGPAAYKFVDFLHHSAQQLWQVLPLGPTGYGNSPYM
SFSALAGNPLLISPEVLCKEGFLAPEDLGGINFPSERVDFDPVVGWKFPLLRRASQTFKQ
QASVEQQQAFEQFCQVKAHWLEDYALFMALLSAGIGEIWTDWPEDIRNRQVEAVQHWRSQ
LQEEIFFHQFLQFEFFRQWTELKTYANDRHIQIVGDIPIYVAHNSADVWTHPEIFQLDPE
TGLAMEMAGVPPDYFSATGQLWGNPVYDWDYLESTGFSWWVERLRSMLDYVDLIRIDHFR
GFEAYWSVPAGEETAIKGRWVKAPGYKLFESIRAELGSLPILAEDLGDIDAAVIELRDHF
QFPGMKILQFAFGSDSHNTYLPFNLTANSVIYTGTHDNNTSQGWYEQISDYERDRLHKYL
GCRSEDGIAWDMIRLALSSVANQAIIPLQDVLGLGAEARMNTPGIAENNWAWRYQQAQLT
ESHSQKLKDMTQIYGRQATK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgcctttttctcgctcaagcggcattttgctgcaccctacttctctgcccggtgactac
gggattggcgatctgggtcctgcggcctacaaatttgtcgactttcttcaccacagcgcc
cagcaactctggcaagtccttcctctggggccaacaggctacggcaattctccctacatg
agtttttctgccctggccggcaatcctctgttgatcagcccggaggttctttgcaaagaa
ggttttttagcaccagaagatttaggggggattaattttccctctgagcgggtagatttt
gatccggtggtgggctggaaatttcccctgttgcgtcgggccagccaaacctttaaacag
caggcctcggttgaacaacagcaagcctttgagcagttctgtcaggtcaaagctcactgg
ttagaagactatgccctgtttatggccctgttgtccgctggcattggggagatctggaca
gattggccagaagatatccgcaatcgtcaagtggaagcggtgcagcactggcgatcgcaa
ctccaggaagaaatcttttttcatcaatttctgcagtttgaatttttccgccaatggact
gaattaaaaacctacgcgaacgatcgccacattcagatcgttggcgatatccccatctat
gttgcccataacagtgccgatgtctggacccacccggaaatctttcagctcgatccagaa
acaggtttggccatggagatggcgggggttcccccagattatttctctgcgactggacag
ctatggggcaacccggtttacgactgggactatctggaatcgacggggtttagctggtgg
gtagaacggctgcggtcgatgctggattacgtcgatctgattcggattgatcattttcgt
ggctttgaagcctactggtccgttccagcgggagaagaaacagccattaaagggcgctgg
gttaaagcccctggttacaagttatttgaatcgattcgggcggaactgggcagtttacca
attctggcagaagatttgggcgatattgatgcagcggtgattgaactacgggatcatttc
cagtttcctggcatgaaaatcctccagtttgcctttggcagcgatagtcataacacctat
ttgcccttcaatctcaccgctaacagtgtgatttataccggaacccacgataataataca
agccagggttggtatgagcaaatttctgactatgagcgcgatcgcttgcacaagtacctg
gggtgtcgcagtgaagatggcatcgcctgggatatgattcggctggccctcagttctgtg
gccaatcaagccattattcccctccaggatgtgctgggcttaggagcagaggccagaatg
aatacccctggaattgctgagaataactgggcctggcgctaccagcaagcccaactcacc
gaatcccacagtcaaaaactgaaggacatgacccagatctacgggcggcaagcaaccaag
taa

DBGET integrated database retrieval system