KEGG   Cyanothece sp. PCC 7425: Cyan7425_1058Help
Entry
Cyan7425_1058     CDS       T00836                                 

Definition
inositol monophosphatase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
cyn  Cyanothece sp. PCC 7425
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:cyn00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(873181..874026)
Genome map
AA seq 281 aa AA seqDB search
MLQELLELARSVGWGASEILQSYYHGDRDLQIRKADSDPVTAADLAVNHYILERLQAELD
PSTFGYLSEETFKPGPPFPQPYVWIIDPLDGTRDFIERTGEFAIHIALVQAGRPVLAIVA
CPEVGKLYYATKGEGTYVENRAGEVTQLRLAQAQQISEMRLVVSRSHRDQRFDQVISRLP
QQEKKYVGSVGGKIATIVEQQAEIYLSLTTKSAPKDWDLAAPELILTEAGGQFTHFDLTP
IEYNRGDVAQWGGFLASTGQHHAELCQFIAQTLEELDSQAE
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgctgcaagagttgcttgagctggctcgctcagtgggttggggcgcatcagagattctc
cagagctattatcatggcgatcgagatctacaaatccgcaaagcagacagtgacccagtg
acggcagcagatctggcagttaatcactatatcctggaacgcctgcaggcagaactagat
ccatcaacctttggctatttaagtgaggaaacttttaagcccggtccccccttcccccaa
ccctacgtctggatcattgaccctttagatggcacccgcgactttatcgaacggacgggg
gaatttgccattcacattgccctggtccaggcgggccgtccggtgctagcgatcgtggcc
tgtcctgaagtggggaagctctactacgccaccaaaggcgagggaacctatgtggaaaac
cgagctggggaagtcacacaactgcgcttggctcaggcacagcaaatcagtgagatgcgg
ttggtagtgagccgaagtcaccgagaccagcgatttgatcaggtgattagccgtttacct
caacaagaaaagaaatatgtggggagcgtgggcggtaagattgcgacgatcgtagagcaa
caggcagaaatttatttgtctctaaccaccaagtctgcccccaaagattgggatctagct
gctccagaactgattctgacggaagcggggggacagttcactcattttgacctcaccccg
atcgaatacaaccggggagatgtggcccagtggggcggattcctggccagtacagggcag
caccatgctgaactctgtcaatttattgctcaaaccctggaagagttagattctcaggcg
gagtaa

DBGET integrated database retrieval system