KEGG   Cyanothece sp. PCC 7425: Cyan7425_1132Help
Entry
Cyan7425_1132     CDS       T00836                                 

Definition
endo-1,4-beta-xylanase
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
cyn  Cyanothece sp. PCC 7425
Brite
Enzymes [BR:cyn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Cyan7425_1132
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
965867..967072
Genome map
AA seq 401 aa AA seqDB search
MRRRDFLIGAGATAGLAAWTGMAQRPEAGGSLRATVQTNATLLAARRQFDLADPLPLRHY
AERKGLRYGAAIQRNYLSRDPEFAACFARECHLLVPEGELKWRTLRPSLNQFNFAPADAL
LQFAQRNQMQMRGHTLVWHQSIPKWFATEVNSRNAERILVNHIQTVMRHYAGKLHSWDVV
NEPIHLKDNRADGLRNSPWLQWLGPDYIELAFRTAAATDPNTLLVLNEFGLDYDTWQWNR
KREALLTLLQKLLSRGTPIHALGIQAHLWARDSLRFFNPDKMRAFLQSVAALGLKILITE
LDVADHQLPAQLEERDRLVAAIYEDYLSVVLEEPAVIAVLTWGLSDRYTWLARYHPRSDQ
LPVRPLPLDAQLQRKLAWNGIARSFSFAPSRSLAFTPLMES
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgcgacggcgggactttctcatcggtgcgggggcaacagcggggttggcggcctggacg
gggatggctcagcggccagaggctgggggttctctaagggctacggttcaaacaaatgcc
accctcctggcagcccgccgtcaatttgacctggcagaccctttgcccctgcgtcattat
gctgaacgtaaaggcctacgctatggagccgcgatccagcgcaactatctgagccgcgat
ccggaatttgctgcctgctttgcccgtgaatgccacctgctggtgccggaaggggaactg
aaatggcgcaccctgcgtcccagtctcaaccagttcaactttgcccccgctgatgccttg
ctgcagtttgcccagcgcaaccaaatgcaaatgcgtggtcataccctggtctggcatcag
agtattcccaaatggtttgccactgaagtgaactcccgcaatgctgagcgaattctggtt
aaccacatccagacggtgatgaggcactatgccggcaagctccattcctgggatgtcgtc
aatgagcccattcatctgaaggataaccgtgccgatgggttacggaactctccctggctg
caatggttaggaccggactatattgagctggcgtttcgcaccgctgctgccactgatccc
aacaccctgttggtcctgaatgagtttgggctggactacgatacctggcagtggaaccgc
aagcgagaggcgctcctcaccttattacaaaaattgctcagtcggggaaccccaattcat
gccctggggattcaagcccacctctgggccagggacagcttgcgattcttcaatccagat
aaaatgagagcttttctgcaatctgtggctgccctgggcttgaaaattctgattacggaa
ctggatgtggcggatcatcagttgcccgctcagctggaggagcgcgatcgcctggtggct
gccatctacgaagattacctcagtgttgtcctggaggaacccgctgtgattgccgtgctg
acctgggggttaagcgatcgctacacctggttggcgcgttaccatccccgttctgatcag
ctgcccgtccgtcccctccccctggatgcccaactgcaacgcaaattggcctggaatggc
attgcccgcagttttagctttgccccctcccgttccctggcttttacgcccctaatggaa
tcctga

DBGET integrated database retrieval system