KEGG   Cyanothece sp. PCC 7425: Cyan7425_1670Help
Entry
Cyan7425_1670     CDS       T00836                                 

Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
cyn  Cyanothece sp. PCC 7425
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cyn01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cyn00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1512633..1513736
Genome map
AA seq 367 aa AA seqDB search
MTQTLVVKIGTSSLTHPKTGDLSLSTIAVLVETLSKLRRQGQRIVLVSSGAVGVGCGRLG
LSERPRTMALKQAVAAVGQGRLMRIYDDFFTTLNQPIAQVLLTRGDLVQRQRYLNAYNTF
QELFNLGVIPIVNENDTVAVDELKFGDNDTLSALVASLVEADWLFLLTDVDRLYSADPRQ
QPDAQPISVVNSIEELAQVQVGDRGSIWGTGGMATKITAAEIAGEAGVRTVITEGRSPVN
IERILAGEALGTQFEPQPRPINARKRWIAHALVPTGKLYLDRGAVQAIAQLGKSLLAAGI
VQVEGVFQSQDAVLLCDRAGQEIGRGLVNYNSQELEKIQGRRSEEIPTILGYSGAETVVH
RDNLVLS
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgacccaaacgcttgttgttaaaattgggacctccagtctgacccatcccaaaactggg
gatttgtcgctttcgaccattgccgtcctggtagaaaccctctccaaattgcggcggcag
ggacaacggatcgttctggtttcttctggagcagtgggagtgggctgtggacggttggga
ttaagtgaacgtccccgcacgatggctctgaagcaggccgtggccgccgtgggacaggga
cgcttaatgcgaatctacgatgatttctttaccacccttaaccagccgatcgctcaggtg
ttattaacgcggggggatctggtgcagcggcaacgctatctcaatgcctataacacgttt
caagagctatttaatctgggggttatcccgatcgtcaacgaaaacgataccgttgcggtg
gatgaactgaagtttggcgacaatgacaccctctctgccctggtggccagcctggtcgaa
gcggactggttattcctgctcaccgatgtcgatcggctttactcggcggatccacgccag
caaccggatgcccaaccgatcagtgtggtgaacagcattgaggaactggctcaggtgcag
gtaggcgatcgcggctcgatctggggtaccggcggtatggctaccaaaattacggcagcg
gaaattgccggggaagcgggggtgcgaacggtgattacggaggggcgatcgccggtcaat
attgagcggattttagccggagaagccctgggcacgcaatttgaaccccaacctcgcccg
attaatgcccgcaaacgctggattgcccatgctcttgttccgacagggaagctgtatctt
gaccggggagcggtgcaggcgatcgcccaactggggaaatctttactggcggcagggatt
gtccaggtagaaggcgtattccagtcccaggatgccgtcctcctctgtgatcgcgctggc
caagagattggcagaggactggtgaactacaacagccaggaactggaaaaaattcagggc
cggcgctccgaagagattccaactatcctcggctatagcggggctgaaaccgtcgtgcac
cgggataatttagttttgagttag

DBGET integrated database retrieval system