KEGG   Cyanothece sp. PCC 7425: Cyan7425_1849Help
Entry
Cyan7425_1849     CDS       T00836                                 

Definition
phosphoketolase
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
cyn  Cyanothece sp. PCC 7425
Pathway
Pentose phosphate pathway
Carbon fixation in photosynthetic organisms
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyn00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Cyan7425_1849
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Cyan7425_1849
Enzymes [BR:cyn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Cyan7425_1849
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1725657..1728098
Genome map
AA seq 813 aa AA seqDB search
MVATPEKPTFDEMRSISAYGEARSTIAGTPLSSEELQNLHAFWRAANYLAVGMIYLRDNP
LLKETLQPEHIKRRLLGHWGSSPGISFLYTHLNRVIKKFGQEMLFMVGAGHGAPGFLGPC
YLEGSYSHFFPECSEDEAGMKQFFKQFSFPGGVGSHCTPETPGSIHEGGELGYSLSHAFG
AAFDNPNLIVVAMPGDGESETGPLATSWHSNKFINPIRDGAVLPVLHLNGYKINNPTILS
RISHRELKALFEGYGYTPYFVEGSDPESMHQALAATLDHCIAEIHTIQQQARSSGQATRP
IWPMIVLRTPKGWTGPVEVDGHRVEGFWRAHQVPMGGMHSNPDHVRQLAAWMKSYKPEEL
FDPDGTLISSIKAQAPTGDRRLGSTPYANGGLLRRDLKMPDFRQYGVAVEKPGTLEVENT
KPLGAFLRDVMKANSTNFRVFGPDENTSNKLHAIYEVSKKFWIADYLPEDADGGELSPDG
RVMEMLSEHTLEGWLEGYLLTGRHGFFSTYESFAHVIDSMFNQHAKWLEICNHIHWRKEI
SSLNLLITSTVWRQDHNGFTHQDPGFLDVVLNKSPDVVRIYLPPDVNTLLSVADHCLRSK
DYINVIVSDKQLHLQYHSMDDAIRNCTKGVAIWDWASNDQGGEPDVVLAAAGDIPTQEAL
AASVLLRENFPDLKIRFINVIDLFMLQPSSEHPHGLSDNDFDSLFTLDKPIIFNFHGYPW
LIHRLTYRRHNHKNLHVRGYKEKGNINTPLDLAIQNQIDRFSIAIDVIDRIHRLKVAGAH
VKESLKNEQIDCRHYAYEHGIDRPDIVNWKWPY
NT seq 2442 nt NT seq  +upstreamnt  +downstreamnt
atggtagccacacccgaaaaacccacctttgatgaaatgcgctcgattagcgcctatggc
gaggcccgctccaccattgccgggacacctctcagtagcgaagagttgcaaaacctccat
gccttctggcgggctgctaactatctggccgtgggcatgatctacctgcgcgacaatcca
ttactgaaggaaaccctccagccggagcacatcaagcggcgcctcctgggccactggggt
tccagtccggggatcagtttcctctatacccacctgaaccgggtgatcaaaaaatttggc
caggaaatgctctttatggtcggtgcggggcatggggcccctgggtttctcggtccttgc
tatctggagggcagctattcccacttcttcccggaatgcagtgaagatgaagcgggaatg
aaacagttcttcaaacagttttctttccctggtggggtgggcagtcactgtaccccggaa
acgcctggctcgattcatgaagggggcgaactcggctacagtctctcccatgcgtttggg
gccgctttcgataatcccaatctgattgtggtagccatgcccggcgatggtgagtcggaa
accggtcccctggctacctcctggcactccaacaaatttatcaacccgatccgcgatgga
gccgtactccccgtcctgcacctgaatggctataagatcaataaccccactatcctctcg
cggatcagccatcgggaactgaaagcgttatttgaaggttacggctatactccctacttt
gtggaaggctctgacccggaatcgatgcaccaggccctggctgccactctagatcactgt
attgccgaaattcataccattcaacagcaagcgcgcagtagtggccaagccacccgtcca
atctggcccatgattgttttgcgcacccccaaaggttggactggacccgtcgaggtggat
ggccacagggtggaaggcttctggcgggctcatcaggtgccgatggggggcatgcacagc
aatcctgaccatgtgcgccagttagcagcctggatgaagagctacaaaccggaagaattg
tttgatcccgatggcactctgatcagttcgatcaaggcccaggcacccaccggcgatcga
cggctgggttcgactccctacgccaatggtggcttactgcggcgcgatctaaagatgccc
gattttcgccagtatggggttgcagttgaaaaaccggggacactggaagtcgaaaatacc
aaacccctgggtgcctttctgcgggatgtgatgaaggccaattcgaccaacttccgtgtc
ttcggccccgatgaaaacacctcgaataaactgcatgcgatttatgaggtgagtaaaaag
ttctggattgccgattacctgccggaggatgcagatgggggggaactctcgccggatgga
cgggtgatggagatgctgagtgagcataccctggaaggctggttggagggctacctgctc
accgggcggcatggcttcttttccacctacgagtcctttgcccacgtgattgactccatg
ttcaatcagcatgccaagtggttagagatttgcaaccatattcactggcgtaaggagatc
tcctccctcaatctgctgattacctcaacggtgtggcggcaggatcacaatggttttacc
catcaagatcccggctttctggatgtggtgctgaacaaaagccccgatgtggtgcgaatt
taccttccccctgatgtcaatacattgctttctgtggcagaccattgcttaaggagtaaa
gactatatcaatgtaattgtctccgacaagcagttgcacctgcagtaccacagtatggat
gacgccattcggaactgcaccaagggggttgcgatctgggattgggccagtaatgaccag
gggggtgaaccggatgtggtgctggcggcggcaggggatattcctacccaggaagcgttg
gctgcctccgtgctgctgcgggagaacttccctgacctgaagatccgtttcatcaatgtg
attgacctgttcatgctgcagcccagtagtgaacatccccacggtctgagtgacaatgat
tttgattctctgttcacgctggacaaaccgatcattttcaatttccacggctatccctgg
ttaattcatcgcctcacctaccgccgacacaatcacaaaaacctgcatgtgcgcggctat
aaggaaaagggcaatattaacacccctctggatctggcaattcagaatcagatcgatcgc
ttcagtattgccattgatgtgattgatcgaattcacagattaaaagtggccggggcccac
gtgaaggaaagcctcaaaaatgagcagatcgattgccgccattatgcctatgaacacggg
atcgatcgccccgatattgtcaactggaagtggccctactaa

DBGET integrated database retrieval system