KEGG   Cyanothece sp. PCC 7425: Cyan7425_2076Help
Entry
Cyan7425_2076     CDS       T00836                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cyn  Cyanothece sp. PCC 7425
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cyn00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1967968..1968825)
Genome map
AA seq 285 aa AA seqDB search
MADLTPWQLRDRWFDWGQRTYLMGILNVTPDSFSDGGQYNSLTAALTQAQTLVQAEMDLL
DIGGQSTRPQAIEISVEEELARVIPVIKAIRQALDIPISIDTTRSEVATAAISAGADLVN
DVSGGTADPQMFATVAALQVPIVLMHRRGTPETMQQLTDYTDLVGEIKQFFVNQIEAAER
AGIKREAISLDPGIGFAKTAEQSLELLRQLGEFRQLGCPLLVGPSRKSFMAKILHQPDPK
QRVWGTAAACCGAIAAGADLIRIHDGAEMRDVCRVADAIWRGSRS
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggctgatctgacaccctggcaattgcgcgatcgctggtttgattgggggcagcgcacc
tacctgatgggcattttgaacgttacccccgatagtttcagtgatggcggccaatacaat
tccctcactgcagcgctgactcaagcccagaccctggtgcaagcggagatggatctgctg
gatattggagggcaatccacccgaccccaggcgatagaaatttcagttgaagaggaattg
gccagggtgatcccggtgatcaaagcaattcggcaggcactggacattcccatttcgatc
gatacgacccgatcggaagttgccaccgctgcaattagcgctggagccgatctggtcaat
gatgtctccgggggaacagccgatccacagatgttcgctaccgttgcggccctgcaggtt
ccaattgttctgatgcaccgccggggtacaccggagacaatgcagcaacttacggactat
acggatctggtgggggagatcaagcagttttttgtcaaccagattgaggcagccgagcga
gcggggatcaagcgggaagcgatctccctggacccaggcattgggtttgccaaaacggct
gagcaaagtttagagctactacggcaactgggggaatttcgccaactggggtgtccgctt
ctggtcgggccgtctcgcaagagttttatggcaaaaatcctccatcaaccggatccaaaa
cagcgggtttggggaacagcggcggcctgttgtggcgcgatcgcggcgggggctgatcta
atcagaattcatgatggcgcggaaatgcgggatgtttgtcgggttgctgatgcaatttgg
cggggatcaagatcgtaa

DBGET integrated database retrieval system