KEGG   Cyanothece sp. PCC 7425: Cyan7425_2509Help
Entry
Cyan7425_2509     CDS       T00836                                 

Definition
family 2 glycosyl transferase
Orthology
K00721  
dolichol-phosphate mannosyltransferase [EC:2.4.1.83]
Organism
cyn  Cyanothece sp. PCC 7425
Pathway
Metabolic pathways
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2468273..2469499)
Genome map
AA seq 408 aa AA seqDB search
MPVSPDLLLALRPFDLLAILLLGWQLPATALLLARLLPGIARKPALVPRSSTLTNLGQVS
IVVPTLNEAQRLPSCLAGLSRQGYEVREILVVDSNSQDGTPDLVKAAAQRDPRYHLLTDD
PLPVGWVGRPWALHTGFLHSHEESEWVLGIDADTQPQPGLVASLLQIAQAEQWDLISLSP
KFILKSFGEWWLQPSLLLTLIYRFGARGDRPVCPERLLANGQCLLIRRSLLVKMGGYSSA
RQSFCDDVTLVRQAAALGAKVAFLDGGQLLQVRMYEGMAETWREWGRSLDLKDATPVAQL
WGDLGFLLAVQGLPLPMSLCLGLAGLSSLSIQLAWGLNLCLVGIRLGMLAAIAGSYDWQK
ATGRRGFWLSPFSDPLAVLRILLSSLQTPKQWRGRTYSTIGSPVSSSQ
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtctctcccgatctgcttttagcccttcgcccttttgatctgctcgcaatcctg
ctgctgggatggcaacttcctgcaaccgccctgctcctggctcggctcttgcccggtatc
gcccgcaaacctgcccttgttccccgttcctccaccctgacaaatctcgggcaggtcagt
attgtggttccgaccctaaatgaagcccaacggctcccttcctgcctggcagggctcagt
cgtcaggggtacgaggtgcgggaaattttggtggtggatagtaactcccaggatggcacc
cccgacctggttaaagctgctgcacaacgggatccccgttatcacctgctcacggatgat
cccctcccagtcggttgggttgggcgcccctgggctttgcacaccggctttctccatagc
catgaagagagtgaatgggtgctgggcattgatgccgatacacaaccccagccaggactc
gtggccagtttgcttcagattgcccaagcagagcaatgggatctaatttccctgtctccc
aaatttattcttaaatcctttggagaatggtggcttcagccctctctgctgctgacgttg
atctaccggtttggggccaggggcgatcgtccggtttgcccagaacggctgctagcgaac
ggtcaatgtctactgatccgtcggtcgttgctggtcaaaatgggagggtatagctctgcc
cgtcagtccttctgtgatgatgtcaccctggtgcgacaggctgctgctctaggggccaaa
gttgcctttctggatgggggtcaactcctccaggtccgcatgtacgaagggatggcagaa
acctggcgggagtggggacgttctttggacttaaaagatgccacgcctgtggcccaactc
tggggagacctgggatttctgctggcggtacaggggctacccttacccatgagtttgtgc
ctgggcctggcagggttatcgtccctatcgatccaactggcctggggtttaaatctttgc
ctggtgggcattcggctggggatgttggcggcgatcgcaggcagctatgactggcagaag
gctacagggcggagagggttctggttatcgcccttcagtgatcccctggcggtgctgcgg
atcttgctttcttcattgcaaactccaaaacaatggcgcggtcgcacctactcaacgatc
gggtcgcccgtgagcagctcgcagtag

DBGET integrated database retrieval system