KEGG   Cyanothece sp. PCC 7425: Cyan7425_2509Help
Entry
Cyan7425_2509     CDS       T00836                                 

Definition
family 2 glycosyl transferase
Orthology
K00721  
dolichol-phosphate mannosyltransferase [EC:2.4.1.83]
Organism
cyn  Cyanothece sp. PCC 7425
Pathway
Metabolic pathways
Brite
Enzymes [BR:cyn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.83  dolichyl-phosphate beta-D-mannosyltransferase
     Cyan7425_2509
Glycosyltransferases [BR:cyn01003]
 N-Glycan biosynthesis
  Dol-P-Man biosyntheisis
   Cyan7425_2509
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2468273..2469499)
Genome map
AA seq 408 aa AA seqDB search
MPVSPDLLLALRPFDLLAILLLGWQLPATALLLARLLPGIARKPALVPRSSTLTNLGQVS
IVVPTLNEAQRLPSCLAGLSRQGYEVREILVVDSNSQDGTPDLVKAAAQRDPRYHLLTDD
PLPVGWVGRPWALHTGFLHSHEESEWVLGIDADTQPQPGLVASLLQIAQAEQWDLISLSP
KFILKSFGEWWLQPSLLLTLIYRFGARGDRPVCPERLLANGQCLLIRRSLLVKMGGYSSA
RQSFCDDVTLVRQAAALGAKVAFLDGGQLLQVRMYEGMAETWREWGRSLDLKDATPVAQL
WGDLGFLLAVQGLPLPMSLCLGLAGLSSLSIQLAWGLNLCLVGIRLGMLAAIAGSYDWQK
ATGRRGFWLSPFSDPLAVLRILLSSLQTPKQWRGRTYSTIGSPVSSSQ
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtctctcccgatctgcttttagcccttcgcccttttgatctgctcgcaatcctg
ctgctgggatggcaacttcctgcaaccgccctgctcctggctcggctcttgcccggtatc
gcccgcaaacctgcccttgttccccgttcctccaccctgacaaatctcgggcaggtcagt
attgtggttccgaccctaaatgaagcccaacggctcccttcctgcctggcagggctcagt
cgtcaggggtacgaggtgcgggaaattttggtggtggatagtaactcccaggatggcacc
cccgacctggttaaagctgctgcacaacgggatccccgttatcacctgctcacggatgat
cccctcccagtcggttgggttgggcgcccctgggctttgcacaccggctttctccatagc
catgaagagagtgaatgggtgctgggcattgatgccgatacacaaccccagccaggactc
gtggccagtttgcttcagattgcccaagcagagcaatgggatctaatttccctgtctccc
aaatttattcttaaatcctttggagaatggtggcttcagccctctctgctgctgacgttg
atctaccggtttggggccaggggcgatcgtccggtttgcccagaacggctgctagcgaac
ggtcaatgtctactgatccgtcggtcgttgctggtcaaaatgggagggtatagctctgcc
cgtcagtccttctgtgatgatgtcaccctggtgcgacaggctgctgctctaggggccaaa
gttgcctttctggatgggggtcaactcctccaggtccgcatgtacgaagggatggcagaa
acctggcgggagtggggacgttctttggacttaaaagatgccacgcctgtggcccaactc
tggggagacctgggatttctgctggcggtacaggggctacccttacccatgagtttgtgc
ctgggcctggcagggttatcgtccctatcgatccaactggcctggggtttaaatctttgc
ctggtgggcattcggctggggatgttggcggcgatcgcaggcagctatgactggcagaag
gctacagggcggagagggttctggttatcgcccttcagtgatcccctggcggtgctgcgg
atcttgctttcttcattgcaaactccaaaacaatggcgcggtcgcacctactcaacgatc
gggtcgcccgtgagcagctcgcagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system