KEGG   Cyanothece sp. PCC 7425: Cyan7425_2651Help
Entry
Cyan7425_2651     CDS       T00836                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cyn  Cyanothece sp. PCC 7425
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:cyn01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cyn01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cyn00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:cyn00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cyn00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cyn00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:cyn00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2604917..2605984
Genome map
AA seq 355 aa AA seqDB search
MPSRKRLGILTSGGDCPGLNAVIRAVVHQAILSYDWEVFGIPYATQGLLERQAISLSLHG
LDLRGIDPLLSMGGTILGSINKGDTLSRVDEILAGYHALELDALIGVGGDGSLTILHQLA
LQGNWQLIGIPKTIDNDVALTQGVVGFDTAVNTITDALNRLTFTAASHDRVMIVEVMGRS
AGHLALHAGIAGGADVILIPEVPYSIESVCRHLNQLRDRWGRKFAIVVVAEGVKTAADSR
TEMMGAKPTCGISQYLANEIMGCLPKPIEVRVSILGHIQRGGIPTAADRLLASAFGKFAV
DLVARGETQQMVAWQCGQVRAVPLVEVISHSPSRVDPNHFLVQTARSLGIYIADA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgccatcgcgtaaacgactggggattttgacaagtgggggggattgtcctgggttgaat
gcggtgatccgggctgttgtccaccaggccatcctttcctatgactgggaggtgtttggc
atcccctacgccacccagggactacttgaacgccaggcgatttccctcagcctgcatgga
ctggatctccgtggtattgatcccctgctcagtatgggtggaaccattctcggcagtatc
aataagggggataccctgtctcgggtggatgagattctggccggctaccacgccttagaa
ttggatgcgctgattggggtgggtggagatggcagtctgaccattttgcatcagcttgcc
ctgcaggggaactggcagttgattggcattccaaagacgatcgacaacgatgtagccttg
acccagggggttgtaggttttgatacggcggttaatacgatcaccgatgccctcaatcga
ctcacttttactgctgccagccacgatcgggtcatgattgttgaggtgatgggacgttcc
gctggccatctggctttacacgctgggattgctggcggggcagatgtgatcttgattccg
gaagtgccctactcgatcgagtccgtctgtcgtcatctcaatcaattacgcgatcgctgg
ggacgcaagtttgcgattgtggtggtggctgaaggggtgaaaactgcggcagattcccgc
acggagatgatgggcgctaaacccacctgtggcatcagtcaatatttggctaatgaaatc
atgggttgtctacctaagccgatcgaagttcgtgtttcaattctgggacatatccagcgg
ggcggtattcccacagcggccgatcgcctcctggccagtgcgtttggtaagtttgccgtc
gatctggttgctagaggagaaacacagcaaatggttgcctggcagtgcgggcaggtgagg
gccgtaccgttggtagaggtgatcagccatagtccatcacgggttgacccgaatcacttt
cttgtccaaactgctcgttctttgggtatttacatcgcagatgcataa

DBGET integrated database retrieval system