KEGG   Cyanothece sp. PCC 7425: Cyan7425_2651Help
Entry
Cyan7425_2651     CDS       T00836                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
cyn  Cyanothece sp. PCC 7425
Pathway
cyn00010  Glycolysis / Gluconeogenesis
cyn00030  Pentose phosphate pathway
cyn00051  Fructose and mannose metabolism
cyn00052  Galactose metabolism
cyn00680  Methane metabolism
cyn01100  Metabolic pathways
cyn01110  Biosynthesis of secondary metabolites
cyn01120  Microbial metabolism in diverse environments
cyn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cyn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cyan7425_2651
   00030 Pentose phosphate pathway
    Cyan7425_2651
   00051 Fructose and mannose metabolism
    Cyan7425_2651
   00052 Galactose metabolism
    Cyan7425_2651
  Energy metabolism
   00680 Methane metabolism
    Cyan7425_2651
Enzymes [BR:cyn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Cyan7425_2651
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Cyan7425_2651
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ACL45004
JGI: Cyan74252651
UniProt: B8HJQ1
Position
2604917..2605984
Genome map
AA seq 355 aa AA seqDB search
MPSRKRLGILTSGGDCPGLNAVIRAVVHQAILSYDWEVFGIPYATQGLLERQAISLSLHG
LDLRGIDPLLSMGGTILGSINKGDTLSRVDEILAGYHALELDALIGVGGDGSLTILHQLA
LQGNWQLIGIPKTIDNDVALTQGVVGFDTAVNTITDALNRLTFTAASHDRVMIVEVMGRS
AGHLALHAGIAGGADVILIPEVPYSIESVCRHLNQLRDRWGRKFAIVVVAEGVKTAADSR
TEMMGAKPTCGISQYLANEIMGCLPKPIEVRVSILGHIQRGGIPTAADRLLASAFGKFAV
DLVARGETQQMVAWQCGQVRAVPLVEVISHSPSRVDPNHFLVQTARSLGIYIADA
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgccatcgcgtaaacgactggggattttgacaagtgggggggattgtcctgggttgaat
gcggtgatccgggctgttgtccaccaggccatcctttcctatgactgggaggtgtttggc
atcccctacgccacccagggactacttgaacgccaggcgatttccctcagcctgcatgga
ctggatctccgtggtattgatcccctgctcagtatgggtggaaccattctcggcagtatc
aataagggggataccctgtctcgggtggatgagattctggccggctaccacgccttagaa
ttggatgcgctgattggggtgggtggagatggcagtctgaccattttgcatcagcttgcc
ctgcaggggaactggcagttgattggcattccaaagacgatcgacaacgatgtagccttg
acccagggggttgtaggttttgatacggcggttaatacgatcaccgatgccctcaatcga
ctcacttttactgctgccagccacgatcgggtcatgattgttgaggtgatgggacgttcc
gctggccatctggctttacacgctgggattgctggcggggcagatgtgatcttgattccg
gaagtgccctactcgatcgagtccgtctgtcgtcatctcaatcaattacgcgatcgctgg
ggacgcaagtttgcgattgtggtggtggctgaaggggtgaaaactgcggcagattcccgc
acggagatgatgggcgctaaacccacctgtggcatcagtcaatatttggctaatgaaatc
atgggttgtctacctaagccgatcgaagttcgtgtttcaattctgggacatatccagcgg
ggcggtattcccacagcggccgatcgcctcctggccagtgcgtttggtaagtttgccgtc
gatctggttgctagaggagaaacacagcaaatggttgcctggcagtgcgggcaggtgagg
gccgtaccgttggtagaggtgatcagccatagtccatcacgggttgacccgaatcacttt
cttgtccaaactgctcgttctttgggtatttacatcgcagatgcataa

DBGET integrated database retrieval system