KEGG   Cyanothece sp. PCC 7425: Cyan7425_3120Help
Entry
Cyan7425_3120     CDS       T00836                                 

Definition
chemotaxis protein CheB
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
cyn  Cyanothece sp. PCC 7425
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:cyn02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:cyn02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3098884..3099501
Genome map
AA seq 205 aa AA seqDB search
MSNSALFPTAAFDVVALATSAGGLNALNQLLSALPANFSAAIVVVQHLSRHSPTVLPQLL
RRHTPLKVKLAEEGDPLTPATVFIAPPNHHLLVNPEGTLQLTHTELVNFTRPAADPLFKS
LATSMGQRTIAVVLTGMGEDGAAGIKAIKRAGGVTIAQDECSAQFKGMPTAAIATGTIDL
VLPLDQIAPMLIKLLNGSNQAHEQS
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
gtgtctaactcagctctttttcctaccgctgcctttgatgtagtcgctctggcaacctca
gcgggaggattaaacgccctgaatcaactcctctccgctctacccgctaacttttcagcc
gcgatcgtggtggtacaacatctgtctcgccactctcccacggttttaccgcaactgctc
cgccgccatacccctctgaaggtgaagctggccgaagagggcgaccccctaaccccggcc
actgtcttcattgctccccccaatcaccatctactggtcaacccagagggcacactccaa
ctcacccacactgagctggtgaatttcacccgaccggccgctgaccctttgtttaagtct
ttagcaaccagtatgggacagcggacgatcgccgttgtgctcacggggatgggggaggac
ggggcggctgggatcaaggcgattaaacgtgcgggaggggtgacgatcgcccaggatgag
tgctcggcccaatttaaaggaatgcccactgctgccattgccaccggaaccatagacctg
gttttaccgctagaccaaattgcccccatgctgatcaagctgttaaacggatcaaaccaa
gcccatgagcagtcctga

DBGET integrated database retrieval system