KEGG   Cyanothece sp. PCC 7425: Cyan7425_3369Help
Entry
Cyan7425_3369     CDS       T00836                                 

Definition
Triose-phosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cyn  Cyanothece sp. PCC 7425
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cyn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cyan7425_3369
   01230 Biosynthesis of amino acids
    Cyan7425_3369
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cyan7425_3369
   00051 Fructose and mannose metabolism
    Cyan7425_3369
   00562 Inositol phosphate metabolism
    Cyan7425_3369
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Cyan7425_3369
Enzymes [BR:cyn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Cyan7425_3369
Exosome [BR:cyn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Cyan7425_3369
  Exosomal proteins of bladder cancer cells
   Cyan7425_3369
  Exosomal proteins of melanoma cells
   Cyan7425_3369
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3326373..3327068
Genome map
AA seq 231 aa AA seqDB search
MHKTQAESLEFLQEFLPHLEQTPEGREVILCVPFTDLAILSQNLHGSRVQLGAQNIHWEK
SGAFTGEISGPMLMEVGVRYVIVGHSERRQYFGETDATVNLRLRAAQAIGLTPILCVGES
KQQRDAGETESHIFNQLEHDLKGVDQTNLVIAYEPIWAIGTGDTCETLEANRVIGLIRSR
LDHKDTPIQYGGSVNPENIDQIMAQPEIDGALVGGASLKGSGFARIVNYQT
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgcataaaacccaggcagagtccctggagttcttacaggagtttttgccccatctagag
caaactccagagggacgggaggtcatcctctgtgtaccctttacagatcttgctattctc
tctcagaacctgcatggcagccgggtacagttgggagcacaaaatattcattgggaaaag
tctggagccttcaccggggaaatttctggccccatgctgatggaggtgggcgttcgttac
gtcattgtcggtcatagtgagcgacgacagtactttggcgagacggatgccacggtgaat
ctgcgcttaagggcagcccaggcgatcggtctaacccccattctctgtgtgggtgaaagc
aaacaacagcgggatgcgggtgaaacggaatcccatatttttaaccagctcgagcatgac
ctgaaaggggtggatcagaccaatctggtgattgcctatgaacccatctgggcgatcggc
acgggagacacctgtgaaaccttagaagccaaccgggtgattggattgatccgtagccgt
ctggaccacaaagacacaccgattcagtacggggggtccgtcaatcccgaaaatattgat
cagattatggcccagccagaaattgatggcgcactggtggggggagcaagcttaaaaggc
agtggctttgcccgcatcgtcaattaccagacctga

DBGET integrated database retrieval system