KEGG   Cyanothece sp. PCC 7425: Cyan7425_3369Help
Entry
Cyan7425_3369     CDS       T00836                                 

Definition
Triose-phosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cyn  Cyanothece sp. PCC 7425
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:cyn01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cyn01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cyn00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cyn00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:cyn00562]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:cyn00710]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3326373..3327068
Genome map
AA seq 231 aa AA seqDB search
MHKTQAESLEFLQEFLPHLEQTPEGREVILCVPFTDLAILSQNLHGSRVQLGAQNIHWEK
SGAFTGEISGPMLMEVGVRYVIVGHSERRQYFGETDATVNLRLRAAQAIGLTPILCVGES
KQQRDAGETESHIFNQLEHDLKGVDQTNLVIAYEPIWAIGTGDTCETLEANRVIGLIRSR
LDHKDTPIQYGGSVNPENIDQIMAQPEIDGALVGGASLKGSGFARIVNYQT
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgcataaaacccaggcagagtccctggagttcttacaggagtttttgccccatctagag
caaactccagagggacgggaggtcatcctctgtgtaccctttacagatcttgctattctc
tctcagaacctgcatggcagccgggtacagttgggagcacaaaatattcattgggaaaag
tctggagccttcaccggggaaatttctggccccatgctgatggaggtgggcgttcgttac
gtcattgtcggtcatagtgagcgacgacagtactttggcgagacggatgccacggtgaat
ctgcgcttaagggcagcccaggcgatcggtctaacccccattctctgtgtgggtgaaagc
aaacaacagcgggatgcgggtgaaacggaatcccatatttttaaccagctcgagcatgac
ctgaaaggggtggatcagaccaatctggtgattgcctatgaacccatctgggcgatcggc
acgggagacacctgtgaaaccttagaagccaaccgggtgattggattgatccgtagccgt
ctggaccacaaagacacaccgattcagtacggggggtccgtcaatcccgaaaatattgat
cagattatggcccagccagaaattgatggcgcactggtggggggagcaagcttaaaaggc
agtggctttgcccgcatcgtcaattaccagacctga

DBGET integrated database retrieval system