KEGG   Cyanothece sp. PCC 7425: Cyan7425_3369Help
Entry
Cyan7425_3369     CDS       T00836                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cyn  Cyanothece sp. PCC 7425
Pathway
cyn00010  Glycolysis / Gluconeogenesis
cyn00051  Fructose and mannose metabolism
cyn00562  Inositol phosphate metabolism
cyn00710  Carbon fixation in photosynthetic organisms
cyn01100  Metabolic pathways
cyn01110  Biosynthesis of secondary metabolites
cyn01120  Microbial metabolism in diverse environments
cyn01130  Biosynthesis of antibiotics
cyn01200  Carbon metabolism
cyn01230  Biosynthesis of amino acids
Module
cyn_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cyn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cyan7425_3369
   00051 Fructose and mannose metabolism
    Cyan7425_3369
   00562 Inositol phosphate metabolism
    Cyan7425_3369
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Cyan7425_3369
Enzymes [BR:cyn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Cyan7425_3369
Exosome [BR:cyn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Cyan7425_3369
  Exosomal proteins of bladder cancer cells
   Cyan7425_3369
  Exosomal proteins of melanoma cells
   Cyan7425_3369
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACL45693
JGI: Cyan74253369
UniProt: B8HPY4
Position
3326373..3327068
Genome map
AA seq 231 aa AA seqDB search
MHKTQAESLEFLQEFLPHLEQTPEGREVILCVPFTDLAILSQNLHGSRVQLGAQNIHWEK
SGAFTGEISGPMLMEVGVRYVIVGHSERRQYFGETDATVNLRLRAAQAIGLTPILCVGES
KQQRDAGETESHIFNQLEHDLKGVDQTNLVIAYEPIWAIGTGDTCETLEANRVIGLIRSR
LDHKDTPIQYGGSVNPENIDQIMAQPEIDGALVGGASLKGSGFARIVNYQT
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgcataaaacccaggcagagtccctggagttcttacaggagtttttgccccatctagag
caaactccagagggacgggaggtcatcctctgtgtaccctttacagatcttgctattctc
tctcagaacctgcatggcagccgggtacagttgggagcacaaaatattcattgggaaaag
tctggagccttcaccggggaaatttctggccccatgctgatggaggtgggcgttcgttac
gtcattgtcggtcatagtgagcgacgacagtactttggcgagacggatgccacggtgaat
ctgcgcttaagggcagcccaggcgatcggtctaacccccattctctgtgtgggtgaaagc
aaacaacagcgggatgcgggtgaaacggaatcccatatttttaaccagctcgagcatgac
ctgaaaggggtggatcagaccaatctggtgattgcctatgaacccatctgggcgatcggc
acgggagacacctgtgaaaccttagaagccaaccgggtgattggattgatccgtagccgt
ctggaccacaaagacacaccgattcagtacggggggtccgtcaatcccgaaaatattgat
cagattatggcccagccagaaattgatggcgcactggtggggggagcaagcttaaaaggc
agtggctttgcccgcatcgtcaattaccagacctga

DBGET integrated database retrieval system