KEGG   Cyanothece sp. PCC 7425: Cyan7425_3762Help
Entry
Cyan7425_3762     CDS       T00836                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
cyn  Cyanothece sp. PCC 7425
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyn00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Cyan7425_3762 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Cyan7425_3762 (pyrB)
Enzymes [BR:cyn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Cyan7425_3762 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3757203..3758174
Genome map
AA seq 323 aa AA seqDB search
MATSWHRRHVLSLADFTAEEFNTVLQSANSFREVLTRRTKKVPTLQARVVANLFFESSTR
TRNSFELAAKRLSADILNFSPGTSALSKGETILDTAKTFWAMGADFMVVRHRESGVPQAI
AAEMDQLGGQVGILNAGDGCHEHPSQGLLDLFTLCTLLDPEQPRLELLAGKKIAIVGDLL
HSRVARSNLWSFKAAGAEVHLAGPPTLLPQEFQQYGAQLHWQLEPALDQADFVMTLRLQK
ERMSQHLIPSLREYHQQFGLTTERLKHCQPHVKVLHPGPVNRGVEISSELMDDPRLSLIS
QQVTNGVAVRMALLYLMSGGGKG
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggctacgtcttggcatcgccgccacgttctttccctggctgattttacagcggaagaa
ttcaacacggttttacaatctgcaaatagttttcgagaagttttaacccgtcgcaccaaa
aaagtgcccacgttgcaagcccgagtggtggccaacttgttttttgagtcttccacccgc
acccgcaatagttttgaactggcggccaagcgcttatccgccgatattctcaacttttca
ccgggaacctctgccctgagtaagggggaaaccattctggatacagcaaaaaccttctgg
gccatgggggcggattttatggtggtgcgccatcgggagtcaggagtgccccaggcgatc
gccgctgagatggatcaattagggggccaggtgggaattctcaatgccggggatggttgc
catgaacatccgtcccaggggttgctggatttatttaccctctgtaccctgttggacccg
gagcaacctcgcctggaactgttagcgggtaagaaaattgcgatcgttggcgatctatta
cattcgcgggtggcccgatcgaatctctggagcttcaaagcggcgggagcagaggttcac
ctggctggtcctccaaccctgctaccccaggaatttcaacagtatggcgcccaactgcac
tggcaattagagccggccttagaccaggcagattttgtcatgaccctgcggctgcagaaa
gaacggatgagccagcatttaattcccagtttgcgagagtatcatcagcagtttggtctg
accaccgagcggttaaaacattgccaaccccacgtcaaggttctgcatccgggcccggtg
aatcgcggtgtagagatcagttcagaactgatggatgatccccgtctcagcctgatttcc
cagcaggtgacgaatggggtggcggtgcggatggcgctgttatatctgatgagtggcggt
ggcaaaggttaa

DBGET integrated database retrieval system