KEGG   Cyanothece sp. PCC 7425: Cyan7425_3762Help
Entry
Cyan7425_3762     CDS       T00836                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
cyn  Cyanothece sp. PCC 7425
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:cyn00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:cyn00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3757203..3758174
Genome map
AA seq 323 aa AA seqDB search
MATSWHRRHVLSLADFTAEEFNTVLQSANSFREVLTRRTKKVPTLQARVVANLFFESSTR
TRNSFELAAKRLSADILNFSPGTSALSKGETILDTAKTFWAMGADFMVVRHRESGVPQAI
AAEMDQLGGQVGILNAGDGCHEHPSQGLLDLFTLCTLLDPEQPRLELLAGKKIAIVGDLL
HSRVARSNLWSFKAAGAEVHLAGPPTLLPQEFQQYGAQLHWQLEPALDQADFVMTLRLQK
ERMSQHLIPSLREYHQQFGLTTERLKHCQPHVKVLHPGPVNRGVEISSELMDDPRLSLIS
QQVTNGVAVRMALLYLMSGGGKG
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggctacgtcttggcatcgccgccacgttctttccctggctgattttacagcggaagaa
ttcaacacggttttacaatctgcaaatagttttcgagaagttttaacccgtcgcaccaaa
aaagtgcccacgttgcaagcccgagtggtggccaacttgttttttgagtcttccacccgc
acccgcaatagttttgaactggcggccaagcgcttatccgccgatattctcaacttttca
ccgggaacctctgccctgagtaagggggaaaccattctggatacagcaaaaaccttctgg
gccatgggggcggattttatggtggtgcgccatcgggagtcaggagtgccccaggcgatc
gccgctgagatggatcaattagggggccaggtgggaattctcaatgccggggatggttgc
catgaacatccgtcccaggggttgctggatttatttaccctctgtaccctgttggacccg
gagcaacctcgcctggaactgttagcgggtaagaaaattgcgatcgttggcgatctatta
cattcgcgggtggcccgatcgaatctctggagcttcaaagcggcgggagcagaggttcac
ctggctggtcctccaaccctgctaccccaggaatttcaacagtatggcgcccaactgcac
tggcaattagagccggccttagaccaggcagattttgtcatgaccctgcggctgcagaaa
gaacggatgagccagcatttaattcccagtttgcgagagtatcatcagcagtttggtctg
accaccgagcggttaaaacattgccaaccccacgtcaaggttctgcatccgggcccggtg
aatcgcggtgtagagatcagttcagaactgatggatgatccccgtctcagcctgatttcc
cagcaggtgacgaatggggtggcggtgcggatggcgctgttatatctgatgagtggcggt
ggcaaaggttaa

DBGET integrated database retrieval system