KEGG   Cyanothece sp. PCC 7425: Cyan7425_3850Help
Entry
Cyan7425_3850     CDS       T00836                                 

Definition
zinc-binding alcohol dehydrogenase protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
cyn  Cyanothece sp. PCC 7425
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cyn00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Cyan7425_3850
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cyan7425_3850
  Lipid metabolism
   00071 Fatty acid degradation
    Cyan7425_3850
  Amino acid metabolism
   00350 Tyrosine metabolism
    Cyan7425_3850
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Cyan7425_3850
   00626 Naphthalene degradation
    Cyan7425_3850
Enzymes [BR:cyn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Cyan7425_3850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3866748..3867722)
Genome map
AA seq 324 aa AA seqDB search
MQLERSGQPLRLVDVPVPTPSPDQVLIRVQACGLCRTDLHIVDGELTQPQLPLIPGHQIV
GRVVEVGAKVTGFAVGDRVGVPWLGSTCHHCRYCLSGQENLCDQARFTGYQINGGYAEFT
VADAHFCFPIPPNYPDLQAAPLLCAGLIGYRSLRMTGQAQRLGFYGFGNAAHLLIQVAHY
QGRQVYAFTRPGDTTAQRFALDLGADWSGGSDSPPPEPLDAAIIFAPVGDLVPIALQAVV
KGGVVVCAGIHMSDIPAFPYAWLWGERVLRSVANLTRRDGEEFLALAPQIPIHTQVTAFN
LTQANEALEALRQGKINGAAVLVI
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgcaactggagcgatcgggacagcccctgcggttagtggatgttcctgtgcccaccccc
agtcctgatcaggttttaatccgtgtgcaggcctgtgggctatgccgtaccgatttacac
atcgtcgatggtgagctgacccaaccgcagcttcccctgattccggggcatcaaattgtc
ggtcgggtggtggaggtgggtgcaaaagtgacaggctttgctgtgggcgatcgcgtcggt
gttccctggctgggttctacctgtcatcattgtcgctactgcttatcggggcaggagaat
ctctgtgaccaggcccgctttaccggataccagatcaatggggggtatgccgaattcacc
gttgccgatgcccacttttgttttccgattccaccaaactatcccgatttacaggccgct
cccctcctctgtgctgggttaatcgggtatcgatcgctgcggatgacggggcaggcccaa
cgtctggggttttacggttttggcaatgcggctcaccttttgattcaggtggcccattat
cagggacgacaggtgtatgcttttacccgaccgggggacacaactgcacaacgctttgcc
ttagacctgggagcggattggagtgggggttcagactctccacctcccgaacccttggat
gcggcaattatctttgctccagtgggggacctggtgccgatcgctctgcaagcagtggtc
aaaggtggggtggtggtttgtgcaggaattcatatgagcgatattccggcttttccctac
gcctggctctggggagaacgggtgctgcgatcggtggccaacctgacccggcgggatggg
gaagaatttctcgcgcttgcgccccaaattccgattcatacccaggtgacggcgttcaac
ctaactcaggcaaacgaagctctggaggcactgcggcagggcaagatcaatggagcggcg
gtactggtgatttag

DBGET integrated database retrieval system