KEGG   Cyanothece sp. PCC 7425: Cyan7425_4120Help
Entry
Cyan7425_4120     CDS       T00836                                 

Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cyn  Cyanothece sp. PCC 7425
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cyn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Cyan7425_4120
Enzymes [BR:cyn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Cyan7425_4120
Exosome [BR:cyn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Cyan7425_4120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4163609..4165903)
Genome map
AA seq 764 aa AA seqDB search
MTLSPDQVDQIISNRHQDPFAILGPHLLEADGTPTWVVRAYLPNAEAAWVLCPDERKEYS
MQTLHHPHFFECTIATPELANYQLRVKEGDHERVIYDPYAFPSPRLTEFDLHLYAEGNHH
RIYEKLGAHPTEVDGVRGVYFAVWAPNARNVSVIGDFNLWDGRQHQMRKGITGIWELFIP
GLSPGEHYKYEIKNAAGHIYEKSDPFGFQQEVRPKTASIVTDLNTYQWQDREWMERRRHT
DPLTQPVSVYEVHLGSWLHESADNPPCSVDGQPLAAVPVADLKPGARFLTYRELAERLIP
YVKELGFTHIELLPIAEHPFDGSWGYQVVGYYACTSRYGTPQDFMYFVDQCHQNGIGVII
DWVPGHFPRDGHGLAFFDGTHLYEHADPRKGEHKEWGTLVFNYSRHEVSNYLIANVLFWM
DKYHIDGIRVDAVASMLYLDYCRKPGEWVANEYGGRENIEAANFLRHLNSLLFSYFPGVL
AIAEESTAWPMVSWPTYVGGLGFNLKWNMGWMHDILDYFHMDPWFRQFHQNNVTFSIWYH
HSENFMLALSHDEVVHGKSNMLGKMPGDEWQKFANLRCLYGFMFAHPGKKTLFMSMEFGQ
WSEWNVWGDLEWHLLQFEPHQKLKQFIQTLNHLYRSQPALHALDLGQDGFEWIDCSDNRH
SVVSFIRRSKDPEDFVIVVCNFTPQPHSHYRVGVPESGFYTELLNSDSREYGGSNLGNLG
GKWTQEWAFHNRPYSLDLCLPPLATLVFKLDRDKSQANLGVYGS
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atgaccctaagccctgatcaggttgaccagattattagcaacaggcatcaagatcctttt
gccatacttgggccccacctgctggaagccgatggtacacccacctgggttgtgcgggct
tacctgcccaatgctgaagctgcttgggtgctttgccccgatgagcgcaaagaatactcg
atgcagaccctgcaccatccccatttctttgagtgcaccattgcgacgccggaactggcg
aattatcaactgcgtgtcaaggaaggcgaccatgaacgggtgatctatgatccctatgcc
tttccctctccgcggctgacggagtttgatctgcacctttacgctgagggcaatcaccac
cgcatttatgaaaagctgggagcgcacccaacggaagtagatggggtgagaggggtctat
tttgcagtttgggcccctaatgcccgtaatgtttctgtgatcggggacttcaacctttgg
gatgggcgccagcatcagatgcgtaaaggcatcacgggcatctgggaattgttcattccg
ggactgagccctggggaacactacaaatacgaaattaagaatgcggctgggcacatttac
gaaaagtctgacccctttggctttcaacaggaagttcgtcctaaaactgcgtcgatcgtc
acggatttgaatacgtatcagtggcaagacagggaatggatggagcgtcgccgtcatacc
gatcctctcacccagccagtttccgtctatgaagttcatctcggttcctggttgcatgaa
tcggctgataatcctccctgctccgtggatggccaacctttagcggcggtacccgtagca
gacctcaaacccggagcgcgatttctcacctatcgggaactggcggaacgcctaattccc
tacgttaaggaattgggttttacccatattgaactgttgccgatcgccgagcatcccttt
gatggttcttggggctatcaggtggtgggctactacgcctgtacttcccgctacggcacc
ccccaggatttcatgtactttgtcgatcagtgtcaccagaatggcattggggtgattatc
gactgggttccaggacattttcccagggatggccacggtttagccttctttgatggcact
catctttatgaacatgccgatccccgcaaaggtgagcataaggaatggggcaccctggtc
tttaattacagccgccatgaggttagcaactacctgattgccaatgtgctgttctggatg
gacaagtaccacatcgatggaattcgggtcgatgctgttgcttccatgctttacctcgac
tattgccgcaaaccgggggaatgggtcgccaatgagtatggggggcgagaaaatattgag
gctgcaaatttcctccgccatctcaatagtctgctgttcagctatttcccaggagtgctg
gcgatcgccgaggaatctactgcctggccaatggtgtcctggccgacctacgtgggcggg
ttagggttcaatctgaaatggaacatgggctggatgcatgacatcctggattatttccac
atggatccctggttccggcagttccaccagaacaatgttacctttagcatctggtatcac
cacagcgaaaactttatgctggccctgtcccacgatgaagtcgtgcatggcaaaagcaac
atgctgggcaaaatgccgggggatgagtggcaaaagtttgctaacctgcgctgcctctac
ggatttatgtttgcccatcctggtaagaaaactctgttcatgagtatggagtttgggcag
tggagtgagtggaacgtttggggagatctggaatggcatctgctccagttcgaaccccat
caaaagctcaaacagtttatccagaccttaaatcacctctatcgcagtcaacctgccctt
catgctctggatctgggccaggacggttttgagtggattgattgtagtgataatcgtcac
agtgtcgtctcctttatccgtcgctctaaggatccagaggattttgtcatcgtggtgtgc
aacttcaccccccaaccccacagccattaccgggtcggtgtgccagaatcaggtttctat
accgaactgctcaacagtgactcccgggagtatgggggcagcaatctgggcaatctgggt
ggtaagtggactcaggagtgggcattccacaatcgtccttactcccttgatctgtgttta
cctcccctggcaacgctggtgtttaagctcgatcgggacaaaagtcaggcaaacctcggt
gtctatggtagttaa

DBGET integrated database retrieval system