KEGG   Cyanothece sp. PCC 7425: Cyan7425_4178Help
Entry
Cyan7425_4178     CDS       T00836                                 

Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
cyn  Cyanothece sp. PCC 7425
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:cyn03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4230083..4230964)
Genome map
AA seq 293 aa AA seqDB search
MPELPEVETVRRGLEQLTLGRKCLGGDVLLQRTISHPFSVAEFLDGLQGTRIECWQRRGK
YLLADLVDANYPKLRRGWLGVHLRMTGQLLWLESSQPLQKHTRVRLFFADAASSLPWELR
FVDQRTFGQMWWVSPEQRPEQIISGWGKLGPEPFSPDFSVAYLFQQLQQSRRPIKNALLD
QTLVAGIGNIYADEALFCSGIHPLTPCAELRPAQVEKLQGAIISVLQASLAEGGTTFSTF
LNVRGVNGNYGGQALVYDRRGEPCHTCGTAIERIKLAGRSTHFCPQCQISSIT
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgaattgcctgaagttgaaacggttcgacgggggcttgagcagctaacccttggc
cgtaaatgtctgggtggggatgtgttactgcaacgaacgatttcccaccccttttctgtt
gcagaatttcttgacggattgcagggaacgcggattgagtgctggcagcggcgaggaaaa
tacctgctagcggatctggtcgatgccaactatccaaagctgagacgaggttggctgggg
gtccatctgcgaatgacgggacagctcctgtggttagagtccagtcaacccctccagaag
cacacccgtgttcgtttattctttgctgatgctgcttcctctcttccctgggaattgcga
tttgtcgatcagcgtacctttgggcagatgtggtgggtgagtccagagcagcggccggaa
cagatcatttctggctggggtaagctcggcccagaaccgtttagcccggatttttccgtt
gcctatttgttccagcaattgcaacagagccgtcgcccgatcaaaaatgcccttttagat
caaaccttagtggcaggcattggcaatatctacgcagatgaggcattgttttgcagtggt
attcatcccctcactccctgtgctgaactgcgacccgctcaagtggaaaaattacagggg
gcgatcatcagtgtcttacaggccagcctggcagagggtggaaccacttttagtacgttt
ctgaatgtcaggggagtaaatggtaattacgggggccaggctctggtctacgatcggcgc
ggggaaccctgtcacacctgtggaacggcgatcgaacgcataaagttggcagggcgctcc
acccacttttgtccgcagtgccagattagctctataacctga

DBGET integrated database retrieval system