KEGG   Cyanothece sp. PCC 7425: Cyan7425_4338Help
Entry
Cyan7425_4338     CDS       T00836                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cyn  Cyanothece sp. PCC 7425
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cyn01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:cyn00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:cyn00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4411466..4412554
Genome map
AA seq 362 aa AA seqDB search
MTLTWPISKSASWSGLINAYRSYLPVTEATPIVTLHEGNTPLIPVPSIAAEIGRQVQVYV
KYDGLNPTGSFKDRGMTMAISKAKEAGAKAVICASTGNTSAAAAAYGRRGGMRVFVLIPD
GYVALGKLAQALVYGAEVLAIQGNFDQALTLVQQLAETQPVTLVNSVNPYRLEGQKTAAF
EVVDALGNAPDWLCIPVGNGGNITAYWMGFCQYREQDRCDRLPRMMGFQAAGSAPLVHGQ
VVTHPETVATAIRIGNPANWQRAMAVRDASQGEFNAVSDAEILAAYRLLASQEGIFCEPA
SAASVAGLLKVKDQVPTGATVVCVLTGNGLKDPDSAIKQQSNQFHQGIPAQLEAVAAVMG
FR
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
gtgaccctaacttggcctatttctaaatctgcgtcctggtcaggtctgatcaacgcctac
cgttcctatttacctgtcacggaagccactccgattgtcaccctgcatgaagggaacacg
cccctgattccggtgcccagcattgccgctgaaattggccggcaagttcaggtctatgtc
aagtacgacggtttgaaccccacgggcagctttaaagatcggggtatgaccatggcgatc
tccaaggctaaggaagccggagccaaggcggtgatctgtgccagtaccggcaatacctct
gcggcggcagcggcctatggacggcggggcggcatgcgggtctttgtcctcatccccgat
ggttatgtcgctctgggaaaattagcccaagccctggtctatggcgcagaggtgctggcc
attcagggcaactttgatcaggcattgaccctggtgcagcaattagccgaaacccagccc
gtcaccctggtgaattccgtcaacccctaccggctggaaggtcagaaaactgctgccttt
gaagtggtggatgccctgggtaatgcccccgactggctctgtattcccgtgggcaatggc
ggcaatatcaccgcttactggatgggattctgtcagtatcgggaacaggatcgttgcgat
cgtctaccccggatgatgggttttcaagcagccggctctgctccccttgtccatggccag
gtggtgacccatcctgaaactgtagcgaccgccattcggattggtaacccggccaactgg
cagcgggcgatggccgtgcgggatgccagccagggagaattcaatgctgtcagcgatgcc
gaaattctcgctgcctaccgtctgctggccagtcaggaagggatcttttgtgaacccgcc
agtgccgcgtccgtcgccggtctattaaaggtgaaagatcaggttccgacgggggcaacg
gtggtctgtgtcctgacggggaatggattgaaagatcctgatagcgcaattaagcagcaa
agtaaccagttccatcagggcatcccagctcagctcgaagccgtggcagccgtgatgggc
ttccgttag

DBGET integrated database retrieval system