KEGG   Cyanothece sp. PCC 7425: Cyan7425_4338Help
Entry
Cyan7425_4338     CDS       T00836                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cyn  Cyanothece sp. PCC 7425
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cyn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cyan7425_4338
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cyan7425_4338
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Cyan7425_4338
Enzymes [BR:cyn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Cyan7425_4338
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4411466..4412554
Genome map
AA seq 362 aa AA seqDB search
MTLTWPISKSASWSGLINAYRSYLPVTEATPIVTLHEGNTPLIPVPSIAAEIGRQVQVYV
KYDGLNPTGSFKDRGMTMAISKAKEAGAKAVICASTGNTSAAAAAYGRRGGMRVFVLIPD
GYVALGKLAQALVYGAEVLAIQGNFDQALTLVQQLAETQPVTLVNSVNPYRLEGQKTAAF
EVVDALGNAPDWLCIPVGNGGNITAYWMGFCQYREQDRCDRLPRMMGFQAAGSAPLVHGQ
VVTHPETVATAIRIGNPANWQRAMAVRDASQGEFNAVSDAEILAAYRLLASQEGIFCEPA
SAASVAGLLKVKDQVPTGATVVCVLTGNGLKDPDSAIKQQSNQFHQGIPAQLEAVAAVMG
FR
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
gtgaccctaacttggcctatttctaaatctgcgtcctggtcaggtctgatcaacgcctac
cgttcctatttacctgtcacggaagccactccgattgtcaccctgcatgaagggaacacg
cccctgattccggtgcccagcattgccgctgaaattggccggcaagttcaggtctatgtc
aagtacgacggtttgaaccccacgggcagctttaaagatcggggtatgaccatggcgatc
tccaaggctaaggaagccggagccaaggcggtgatctgtgccagtaccggcaatacctct
gcggcggcagcggcctatggacggcggggcggcatgcgggtctttgtcctcatccccgat
ggttatgtcgctctgggaaaattagcccaagccctggtctatggcgcagaggtgctggcc
attcagggcaactttgatcaggcattgaccctggtgcagcaattagccgaaacccagccc
gtcaccctggtgaattccgtcaacccctaccggctggaaggtcagaaaactgctgccttt
gaagtggtggatgccctgggtaatgcccccgactggctctgtattcccgtgggcaatggc
ggcaatatcaccgcttactggatgggattctgtcagtatcgggaacaggatcgttgcgat
cgtctaccccggatgatgggttttcaagcagccggctctgctccccttgtccatggccag
gtggtgacccatcctgaaactgtagcgaccgccattcggattggtaacccggccaactgg
cagcgggcgatggccgtgcgggatgccagccagggagaattcaatgctgtcagcgatgcc
gaaattctcgctgcctaccgtctgctggccagtcaggaagggatcttttgtgaacccgcc
agtgccgcgtccgtcgccggtctattaaaggtgaaagatcaggttccgacgggggcaacg
gtggtctgtgtcctgacggggaatggattgaaagatcctgatagcgcaattaagcagcaa
agtaaccagttccatcagggcatcccagctcagctcgaagccgtggcagccgtgatgggc
ttccgttag

DBGET integrated database retrieval system