KEGG   Cyanothece sp. PCC 7425: Cyan7425_4397Help
Entry
Cyan7425_4397     CDS       T00836                                 

Definition
carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
cyn  Cyanothece sp. PCC 7425
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4465785..4466549
Genome map
AA seq 254 aa AA seqDB search
MLTNTPFLLTSSDRERACLLLHGLGGGVYEMQLLGQHLWESGFTVQGILYPGHDQPCERM
PRSTWQEWYGHVQESYEKLQQTYAQVTVVGFSTGCLLALHLAAHYPVDRVVLLCPYLLIR
RQWFYLLPLEAYLFSIGWLLEDVPRWRLPLTDPIMHELALKAAFFRSFNLSAVRSAIELI
ALVKTELSSITQPTLIIQSKKDTVVDPSGAAYLYHHLPTPQKQLIWLQNSDHIIPLDQER
AQVFALVRQFLNPA
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgttaaccaataccccttttctgctgacctccagcgatcgcgaacgcgcctgtctgctc
ctgcatggactggggggtggagtgtatgaaatgcaactgttgggccagcatctgtgggaa
agcggcttcaccgtccagggaattctctatccgggtcatgatcaaccctgtgagcggatg
ccccgatccacctggcaggagtggtatgggcatgtgcaggagagctatgagaagctacaa
cagacctacgctcaagttaccgtggtaggcttttccacaggttgtctcctggccctgcat
ctagcggcccactaccccgtcgatcgcgtcgttctgctctgcccctatctgctgattcgc
cgccagtggttttatctcctgcccctggaagcctatctgttctcgatcggttggctgttg
gaggatgttccccgctggcgtttacccctcaccgatccaatcatgcacgagctggccctc
aaagccgctttttttcgtagctttaatctcagtgccgttcgcagcgcgatcgagttaatt
gcactggtgaaaacagagctatccagcattacccagcccaccctgattattcaatccaaa
aaagataccgttgtcgatccctccggggcagcctatctctaccaccatctgccaacccct
cagaagcaactgatctggttgcagaattcggaccacatcattcccctcgatcaggagcgt
gcccaggtctttgccttggtgagacagtttcttaatcctgcttaa

DBGET integrated database retrieval system