KEGG   Cyanothece sp. PCC 7425: Cyan7425_4423Help
Entry
Cyan7425_4423     CDS       T00836                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
cyn  Cyanothece sp. PCC 7425
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cyn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cyan7425_4423
   01230 Biosynthesis of amino acids
    Cyan7425_4423
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cyan7425_4423
  Energy metabolism
   00680 Methane metabolism
    Cyan7425_4423
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cyan7425_4423
Enzymes [BR:cyn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Cyan7425_4423
Exosome [BR:cyn04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Cyan7425_4423
  Exosomal proteins of melanoma cells
   Cyan7425_4423
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4493358..4494026)
Genome map
AA seq 222 aa AA seqDB search
MQLLWIRHAESIANQRGEMQGQGDSALSERGRQQAIALGRYLADQSWSPSHVYSSPLGRA
IATAAILVETLRVVGNSDDVPAVIQEPDLQEISNGIFQGLTWAEAQLNYPHLCEQLESNL
SWIPIPGAETLEQLHDRSHRFIQNLLKNHQNDDRLWIISHAGILPYLMAALMGSDRVWGL
TIPCTALFEFEFNLDYWHCGDHNRYNTALWQLHRFNQVIAEV
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgcagttgctctggattcgtcatgctgagtcgatcgctaatcaacggggcgaaatgcag
ggacagggagattcagccctatcggaacggggacggcaacaggcgatcgccttggggcgc
tatctggctgaccagtcctggagtccttcccatgtctatagcagtcctctggggcgggcg
atcgcaaccgctgcaattctagttgaaaccttaagggtggttggcaattcagacgatgtg
cctgcagtgatccaggaaccggatttacaggagatcagtaacggaatttttcagggatta
acctgggcagaggctcaactcaactatccacacttgtgtgagcaactggagtcaaatttg
agctggatacccattccgggggcggaaaccctggagcagcttcacgatcgcagccatcgt
tttatccaaaatttacttaaaaaccatcagaatgacgatcggctctggattatttctcac
gctggaattttgccctatttaatggcagctttaatgggaagtgatcgggtctggggctta
acgattccctgcacggccctgtttgaatttgagtttaatttagactactggcattgtggc
gaccacaaccgttacaataccgctctctggcaactgcatcggttcaatcaggtcattgca
gaggtttaa

DBGET integrated database retrieval system