KEGG   Cyanothece sp. PCC 7425: Cyan7425_4423Help
Entry
Cyan7425_4423     CDS       T00836                                 

Definition
(GenBank) Phosphoglycerate mutase
Organism
cyn  Cyanothece sp. PCC 7425
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(4493358..4494026)
Genome map
AA seq 222 aa AA seqDB search
MQLLWIRHAESIANQRGEMQGQGDSALSERGRQQAIALGRYLADQSWSPSHVYSSPLGRA
IATAAILVETLRVVGNSDDVPAVIQEPDLQEISNGIFQGLTWAEAQLNYPHLCEQLESNL
SWIPIPGAETLEQLHDRSHRFIQNLLKNHQNDDRLWIISHAGILPYLMAALMGSDRVWGL
TIPCTALFEFEFNLDYWHCGDHNRYNTALWQLHRFNQVIAEV
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgcagttgctctggattcgtcatgctgagtcgatcgctaatcaacggggcgaaatgcag
ggacagggagattcagccctatcggaacggggacggcaacaggcgatcgccttggggcgc
tatctggctgaccagtcctggagtccttcccatgtctatagcagtcctctggggcgggcg
atcgcaaccgctgcaattctagttgaaaccttaagggtggttggcaattcagacgatgtg
cctgcagtgatccaggaaccggatttacaggagatcagtaacggaatttttcagggatta
acctgggcagaggctcaactcaactatccacacttgtgtgagcaactggagtcaaatttg
agctggatacccattccgggggcggaaaccctggagcagcttcacgatcgcagccatcgt
tttatccaaaatttacttaaaaaccatcagaatgacgatcggctctggattatttctcac
gctggaattttgccctatttaatggcagctttaatgggaagtgatcgggtctggggctta
acgattccctgcacggccctgtttgaatttgagtttaatttagactactggcattgtggc
gaccacaaccgttacaataccgctctctggcaactgcatcggttcaatcaggtcattgca
gaggtttaa

DBGET integrated database retrieval system