KEGG   Cyanothece sp. PCC 7425: Cyan7425_4519Help
Entry
Cyan7425_4519     CDS       T00836                                 

Definition
hypothetical protein
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
cyn  Cyanothece sp. PCC 7425
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:cyn00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:cyn00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4596028..4598472)
Genome map
AA seq 814 aa AA seqDB search
MKNNATPPHSIPSCAWSRPIGLGWSNPYKVRYPSNLDDGPFHGMPLGGFGAGCVGRSHRG
DFNLWHIDGGEHVFQSLPACQFSVFEQVGQSPGKAYSLSTVAPEDGSLNSWQWYPQSGGS
YHALYPRSWFVYQNVFQADLVCEQFSPILTENYQETSYPVAVFHWTAHNPTDQPLTLSLM
LTWQNVVGWFTNADKSPVVKVRDDGSPVYTYQPRLGESQGNFNRVIDDNGRVGFVLDRLR
SEEAAIAEGEGQWAVATFASPYTSEVFYYTRWNPVGDGSELWQTFAADGSLANCDDETPA
GVGEQIAAAIAVRFTLPPGQTRQIPFVLAWDFPVTEFAAGVNYFRRYTDFFGRTGDHGWA
IARTGLKMHQTWTDQIQAWQQPILDSNEPDWFKMALLNELYDLTSGGTLWSAADERDPIG
QFAVLECLDYRWYESLDVRLYGSFALLLLWPRLEKAVMEAFARAIPTQDDRTRVIGYYYT
QGMPSPTALHKIANATPHDLGAPNEHPWEKTNYTSYQDCNLWKDLPADFVILVYRDYLLT
GGTDYDFLTTCWPAIHATLAYLKTFDLDGDGIPENSGAPDQTFDDWRLQGISAYCGGLWI
AALEAAIAIIKLLLVQAPDLPHLQESLTTYQTWLAQSRPLYQQTLWNGQYYRLDSGSGSD
VVMADQLCGQFYARLVGLPDVVPEDCARAALDMVYQTCFLQFHNGTLGAANGLRPGGLAE
KPDATHPLEVWTGINFGLAAFLVQMGRKAEAMQLTAAVVYQIYEHGLQFRTPEAITAEQT
FRAGMYLRPMAIWAIYHLLTSHANPNPESPRSPT
NT seq 2445 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaataacgctacccctccgcattccatcccttcctgtgcctggagccgtccgatc
ggtctgggttggtccaatccctacaaagttcgctatcccagcaatctggatgatggcccc
tttcacggtatgcccctgggtgggtttggggccggttgtgtgggccgatcgcaccggggt
gacttcaacctctggcacattgatggcggggaacacgtttttcaaagtttaccggcctgt
cagttcagtgtatttgagcaggtggggcagtccccaggcaaggcttatagcttatcgacc
gtcgccccagaggatggttcgctcaattcctggcaatggtatccccaatctggtggcagc
tatcatgccctctatccccgcagttggtttgtctatcaaaatgtatttcaggcagatctg
gtctgtgagcagttttcaccgatcctgaccgaaaattaccaggagaccagctatccggta
gccgtttttcactggacggcccacaaccccacggatcaaccgctcaccctcagcctgatg
ctgacctggcaaaatgtggtgggctggtttaccaatgccgataaatctccagtggtgaaa
gtgcgggatgatggcagtccggtctacacctatcaaccgcgattgggagaaagtcagggc
aattttaatcgcgtgattgatgataacgggcgggttggctttgtcctcgatcggctccgc
agtgaagaggctgcgatcgctgaaggagaggggcagtgggccgtcgctacctttgcatct
ccttacacctcagaagtgttttattacacgcgctggaatcccgttggggatggctccgaa
ctgtggcagacgtttgcagccgatggttccctggccaattgtgatgatgaaacccctgct
ggggtgggtgaacaaattgctgcggcgatcgcggttcgtttcaccctgcctcccggtcaa
acccgtcagattccctttgttttggcctgggattttccggtcaccgaatttgcggctggg
gttaactatttcaggcgatataccgatttctttggccgcaccggagaccatggctgggcg
atcgcccgtacgggcctgaaaatgcaccagacctggacggaccaaattcaagcctggcag
caacccattctggatagcaatgagccggactggttcaagatggccctcctgaacgaactc
tacgacctcaccagtgggggaacgctatggagtgccgcggatgaacgcgatccgatcggc
cagtttgccgtgctggaatgcctggactatcgctggtacgaaagtttagatgtgcgcctc
tatggttcctttgccctgctgttgctctggccgcgcctggaaaaagcagtgatggaagcc
tttgcccgcgccattcccacccaggacgatcgcacccgcgtgattggctattactacacc
caggggatgcccagccccaccgccttacataagattgccaacgccaccccccacgattta
ggcgcacccaacgaacatccgtgggaaaaaacgaattacaccagctatcaggactgtaat
ctctggaaagacctccccgccgattttgtcatactcgtctatcgcgattatctgctcaca
ggcggaacggattacgactttctgaccacctgctggcccgcgattcacgccaccctggcc
tacctgaaaacctttgacctggatggcgatggcattcccgaaaattccggtgctcccgac
caaacctttgatgactggcggctccagggcatcagtgcctactgtggcggcttgtggatt
gcggccctggaagcggcgatcgccatcattaagctcctcctcgttcaggctcccgatctg
ccccacctgcaggaaagcctcaccacctaccagacctggctggcccaatcccgtcccctc
tatcaacaaaccctctggaatgggcagtattatcggctggacagtggcagtggttccgat
gtggtgatggccgatcagctctgtggtcagttctatgctcgtctggttggcttgccagat
gtggtgccggaagactgcgctcgagcggctttagatatggtctatcaaacctgctttctg
cagtttcacaatggtacgctgggagcggcaaatggactgcggcccggtggtttagccgaa
aaacccgatgccactcatcccttagaagtctggacagggattaattttggtctagccgct
tttctggtgcagatggggcgcaaagccgaggcgatgcagttaacagcggccgtggtgtac
cagatttatgagcatggtctgcagttccgtacccctgaagcgattacagccgaacagacg
ttccgggcgggcatgtacctgcggccgatggcgatctgggcaatttaccacctgctcaca
tcccatgccaatcccaatccagaatcaccccgatcaccgacctga

DBGET integrated database retrieval system