KEGG   Cyanothece sp. PCC 7425: Cyan7425_4724Help
Entry
Cyan7425_4724     CDS       T00836                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cyn  Cyanothece sp. PCC 7425
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cyn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cyan7425_4724
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cyan7425_4724
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Cyan7425_4724
Enzymes [BR:cyn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Cyan7425_4724
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4810131..4811366)
Genome map
AA seq 411 aa AA seqDB search
MPVALPSEANALPDALGRFGQFGGKYVPETLMPALSELEAAFARYCQDEDFQTELQQLLR
DYVGRPTPLYFAERLTAHYAHAQGSPQIYLKREDLNHTGAHKINNALAQVLLAKRMGKKR
IIAETGAGQHGVATATVCARFGLQCVIYMGVQDMERQSLNVFRMRLMGAEVQPVSAGTGT
LKDATSEAIRDWVTNVENTHYILGSVAGPHPYPMLVRHFQSIIGQETRAQCLQKWNGLPD
ILLACVGGGSNAMGLFYEFLDEPSVRLIGIEAAGEGLNSPRHAATLTRGQIGVLHGAMSY
LLQDEDGQVVEAHSISAGLDYPGVGPEHSYLKDAGRAEYYSITDAEAVAALQRTAQLEGI
IAALETSHALAYLETLCPQLTGQPRIVINCSGRGDKDVQTVAKYLEEQAKG
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgcctgttgctctgccatccgaagccaatgccctccccgatgccctcggtcgctttggt
caatttgggggaaagtatgtccctgaaaccctgatgcccgctctgagtgagctggaagct
gcctttgcccggtattgccaggatgaagatttccagacggagctacagcaactgctgcgg
gattatgttggccgtcccacccccctttactttgctgaacgcttaacagcccactacgcc
catgcccagggaagtccccaaatttatctgaaacgggaagatctgaaccatacaggggcc
cataaaattaacaacgccctggcccaggtgctgctggctaagcgtatgggtaaaaagcgg
attattgctgagactggtgctgggcagcatggggtagccacagcaaccgtctgtgcccgt
tttggtctgcagtgcgtgatttacatgggcgtgcaggacatggagcggcaaagtttgaat
gtatttcggatgcggttgatgggggcagaagtgcaacctgtgtctgcgggaaccggaacc
ctcaaggatgccacttcggaagcgatccgggattgggtcaccaatgttgaaaatacccat
tatattcttggttcggtggccggacctcatccttacccgatgctggtgcgccactttcag
agcattattggtcaggaaacccgtgctcagtgcctgcagaagtggaatgggttacccgat
atcctgctggcttgtgtgggtggggggtctaatgccatgggactattttatgaatttctg
gatgaacccagcgtgcgattgattgggatcgaagcggccggagaagggctgaattctccc
cgtcatgctgctaccctcacccgtggccagattggtgttctgcacggagccatgagctat
cttttacaggatgaagatggccaggtggtggaagcccattccatcagtgccggtctggat
taccctggcgtggggccggaacacagttacctcaaggatgccggtcgggcagaatattac
agtatcaccgatgctgaagcggtggcggcgctgcaacggacagcccagttagaaggcatt
attgctgctctggaaacgtcccatgctctcgcttatctggaaaccctctgtcctcaactg
accggccagccccgaattgtgatcaactgctccggtcgaggcgataaagatgtccaaacg
gtggctaaatacctggaagagcaggcaaaagggtag

DBGET integrated database retrieval system