KEGG   Cyanothece sp. PCC 7425: Cyan7425_4960Help
Entry
Cyan7425_4960     CDS       T00836                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cyn  Cyanothece sp. PCC 7425
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cyn00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Cyan7425_4960
Enzymes [BR:cyn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Cyan7425_4960
Peptidases [BR:cyn01002]
 Cysteine Peptidases
  Family C44
   Cyan7425_4960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5044592..5046388
Genome map
AA seq 598 aa AA seqDB search
MCGIAGLLSAKSPPNNLHVLLERMNFAQQHRGPDDQGIYISPCSLGALAHSRLSILDLSS
AGHQPMSLAQGRFWISFNGEIYNYLELRQKLEAQGETFISNTDTEVILKLFQLYGKDCLK
HLRGMFAFALWDEQQQGCFLARDPLGIKPLYFWSSGDYFLFASEIKALLATGLVSKEIDS
TGLYGYLINGSVPEPYTLIKSVQLLKAGHFLAWKSGIVTQEQYWQIQFKSQTVDQFEAVE
KTRSALTSTIEAHLISDVPVGIFLSGGIDSSTIVALSRQSQAQQLRTYSISFEEKFWNEG
DVARRVANHFKTTHSEHLVSSQLGRELLSRFFAAIDQPTIDGFNTFCISYFAHQNGAKVV
LSGLGGDELFGGYNIFQRLPQMLNYGKISDFLQPYSHWLGNGLEYFHYFTACRKIGRFLQ
SSPTLDTAYSIFRSIFLHEEALKIIDYYFPDLPPPELSCEDPVFEFPFVEDTISFLELSR
YMRNQLLRDSDVMSMTWGLELRVPFVDSMLVDTLASIPAPIRLAQGKRLLKQAVPELPDW
LLKLPKKGFTFPLPLWLSSEWRDIYSSTGFPPGISLKSWYRRWSLFILMNWWQRIIQT
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggcatcgctggtttactcagtgccaaatccccccctaataaccttcacgtctta
ttggagcggatgaactttgctcagcagcatcgagggccagatgaccaaggcatatatatt
tcaccttgctctttaggagcgctagcccatagtcgcctttcgattctcgatctttcatcg
gctggacatcaacccatgtctttggctcaagggcgtttctggatcagttttaacggcgaa
atttacaattaccttgagctacggcaaaaactagaagctcagggcgaaacgtttatatcc
aacactgacactgaagtcattcttaagctttttcagctttatggaaaagattgtttaaaa
cacctccgggggatgttcgcctttgctctgtgggacgaacagcaacagggctgttttcta
gcacgagatcctttgggaattaagcccttgtacttttggtcttccggcgattattttctg
tttgcctctgaaattaaggcgctgctggctacagggttagtttctaaggagatcgattca
acaggtttgtatgggtatctgatcaatggatctgttcccgaaccctatactttaattaaa
agtgttcagctcttaaaggcagggcactttttagcatggaagtcaggaatcgttacccag
gaacaatactggcagattcaatttaagagccaaaccgtagaccagtttgaagcagttgaa
aagactcgctcggcattaacctccactattgaagctcatttaattagcgatgtccccgta
ggtatcttcctcagcggcggaattgactccagcactattgttgccctgtccaggcaatct
caagcccagcaactccgcacctactctatttcttttgaggaaaagttttggaacgagggg
gatgtagcccgccgtgttgcgaaccatttcaaaacaactcacagtgagcatttagtatct
tctcaacttggacgagagctactgagccgattttttgctgctattgatcagccaaccatt
gatgggtttaataccttttgcatttcttactttgcccatcagaatggagctaaagtcgtt
ctttcaggtttgggtggagacgagttattcggtggatataacatctttcaacggcttccc
caaatgcttaattacggtaaaatttcagactttctacaaccctatagccactggttgggg
aatgggttagagtattttcattattttacagcgtgtcgaaaaatcggcagattcctgcaa
agttcacccacactcgatacagcttacagtatttttcgcagtatcttcttgcatgaggaa
gcattaaaaatcattgactactactttcctgatctacctccacctgaactgtcctgtgaa
gacccagtttttgaattcccttttgttgaggataccattagttttttagaacttagtcgc
tatatgcgtaatcaactgttgcgcgacagtgatgtgatgagcatgacttggggtttagag
ttacgagttccctttgtagatagcatgcttgttgatacgctagcatcaattccggctccg
attcgactagctcaaggtaagcgtttactgaaacaggctgttcccgaattacctgactgg
ctgctaaaactgcctaaaaaaggatttacctttcctttgccactctggttatccagtgaa
tggcgagacatttatagcagcactggttttcctccaggtatttctctgaaatcttggtat
cgtcgttggagcttgtttattctgatgaactggtggcagcgtatcatccagacatga

DBGET integrated database retrieval system