KEGG   Cyanothece sp. PCC 7425: Cyan7425_4977Help
Entry
Cyan7425_4977     CDS       T00836                                 

Definition
branched-chain alpha-keto acid dehydrogenase subunit E2
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cyn  Cyanothece sp. PCC 7425
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cyn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Cyan7425_4977
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cyan7425_4977
   00020 Citrate cycle (TCA cycle)
    Cyan7425_4977
   00620 Pyruvate metabolism
    Cyan7425_4977
Enzymes [BR:cyn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Cyan7425_4977
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5062119..5063417)
Genome map
AA seq 432 aa AA seqDB search
MIHEVFMPALSSTMTEGKIVSWTKSPGDKIAKGETVVIVESDKADMDVESFYEGYLAAIS
TPAGSVAPVGATIGLVAETEAEIAEAQAKVAQQASSAPAPAAETVPSPVATSPVEIKAEP
GLALATPSGRTVASPRARKLAKELNIDLSTLRGSGPHGRIVAEDVEAAAGLVKAAPAIAL
PTAPAPQPNGHRTPTPAVTAPTVAPAVMPGETVPLSTLQQAVVRNMLASLEIPDFHVAYT
LTTDALDQLYKQIKSKGVTMTALLAKAVALTLQKHPIINACYSDGGIQYRANINIAIAVA
MPGGGLITPVLKNADQQDIYSLSRTWKDLVERARAKQLQPDEYTTGTFSLSNLGMYGVDS
FDAILTPGQGAIMAIGAALPQVVATEDGLFGIKRQMKVNITCDHRVIYGADAAAFLQDLA
KLVATDPQALLL
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgatccatgaagttttcatgcccgcccttagctccaccatgacggaaggtaagattgtc
tcctggacaaaatcccctggggacaaaattgccaaaggggaaacggtggtgatcgtggag
tcagacaaggctgacatggatgtggagtccttctatgagggctatctggctgcgatctcc
acgcctgccggtagtgttgcccccgtcggagccacgatcggtctggttgcggaaacagag
gcagaaattgctgaagctcaggctaaagttgctcaacaagcttcttctgcgccagccccc
gccgctgagacggttcccagtccggttgccaccagcccggttgagatcaaagctgagcct
ggtcttgccctggccacgccttcaggacgcacggtggcttctccccgggcccgcaagctg
gctaaagaactcaacattgatctgagtacgctgcggggaagtggcccccacggtcgaatt
gtggcggaagatgtggaagctgcagcgggattggtcaaagcagccccggcgatcgctcta
cccacggctccggctccccaacccaatggccaccgtacccccaccccagcggttacagct
ccaacggtggctccagcggtgatgcccggcgaaacggttcccctcagcactttgcagcag
gctgtggtgcgcaatatgctggccagtctggagatcccggacttccacgttgcctacacc
ctcaccactgatgcccttgatcagttgtacaagcagattaagtcgaaaggcgtgacaatg
acagcgttactggctaaggccgttgccctgacgctgcaaaagcatccgatcatcaatgcc
tgctatagcgacgggggcattcagtatcgcgccaacattaacattgccattgccgttgcc
atgcccggtgggggtttaattaccccagtgcttaaaaatgctgaccagcaggatatttat
agcctgtcccgtacctggaaagacctggtggagcgggcccgagccaagcaactccagccg
gatgaatacaccaccgggaccttcagcctgtctaatctcggtatgtatggggtggatagt
tttgatgctattctcacccccggtcagggtgcgattatggcgatcggcgctgcccttccc
caggttgtggctacagaagacggcctgtttgggatcaaacggcagatgaaagtgaacatc
acctgtgatcaccgcgtgatctatggtgcagatgccgccgccttcctccaggatctggct
aagctggtagctaccgatccccaggctttattgctctaa

DBGET integrated database retrieval system