KEGG   Cyanothece sp. PCC 7425: Cyan7425_4981Help
Entry
Cyan7425_4981     CDS       T00836                                 

Definition
(GenBank) magnesium chelatase, H subunit
  KO
K03403  magnesium chelatase subunit H [EC:6.6.1.1]
Organism
cyn  Cyanothece sp. PCC 7425
Pathway
cyn00860  Porphyrin and chlorophyll metabolism
cyn01100  Metabolic pathways
cyn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cyn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cyan7425_4981
Enzymes [BR:cyn01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Cyan7425_4981
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CobN-Mg_chel DUF3479
Motif
Other DBs
NCBI-ProteinID: ACL47279
JGI: Cyan74254981
UniProt: B8HNF2
Position
5066594..5070586
Genome map
AA seq 1330 aa AA seqDB search
MFTHVKSTIRHVAPADLQGRSLMRVVYVVLEAQYQSALTAAVRSINQHNPNLAIEISGYL
IEELRDPDNYAAFQQDVAQADVFIASLIFLEDLADKVVEAVAPHRDRLDVAVVFPSMPQV
MRLNKMGSFSMANLGQSKSVIAQFMKKRKEKSGAGFQDAMLKLLRTLPQVLKYLPMDKAQ
DARNFMLSFQYWLGGSPENLENFLLMLADKYVFKGEKGQAALTNYRDPVAYPDMGIWHPL
APEMFEDVREYLNWFNSRRDISADLKDPLAPTVGLVLQRTHLVTGDDAHYVALVQELESE
GARVIPVFAGGLDFSKPVEAYFYDPAAIKESTALVDVVVSLTGFALVGGPAKQDHPKAIA
ALKKLNRPYMVALPLVFQTTEEWEDSDLGLHPIQVALQIALPELDGAIEPIILSGRDGTT
GKAIALQDRVETIAQRAMKWASLRRKPKITKKVAITVFSFPPDKGNVGTAAYLDVFGSIY
KVMEALKHNGYDIENLPESAEALMQEVIHDAQAQYSSPELNIAYKMPVPEYETLTPYSRK
LEESWGKPPGHLNSDGQHLLIYGKHYGNLFIGVQPTFGYEGDPMRLLFSRSASPHHGFAA
YYTYLNKIWKADAVLHFGTHGSLEFMPGKQIGMSGDCYPDSLIGTIPNLYYYAANNPSEA
TIAKRRSYANTISYLTPPAENAGLYKGLKELSELIASYQTLKDSGRGVPIVNTIMDKCRL
VNLDKDINLPEIDAAEMEAADRDAIVGQVYIKLMEIESRLLPCGLHVIGKPPSAAEAIAT
LVNIASLDREEEGIKGLPRLLAESLGRDLEEIYQNSDRGILADVERLQSINQATRAAVTA
LVETQADADGRISRVSKLNFFNMGRKEPWIEALHQAGYPKVDSEQLKPLIEYLEFCLKQI
VADNELGALLQALEGEYILPGPGGDPIRNPDVLPTGKNIHALDPQSIPTAAAVKSAKVVV
DRLIARQKIENNGAWPETIALVLWGTDNIKTYGESLAQVMWMVGVRPLPDSLGRVNKLEL
IPLEELGRPRVDVVVNCSGVFRDLFVNQMELLDKAIKMAAEADEPLEMNFVRKHALKQAE
DMGINLRQAATRVFTNASGSYASNVNLAVENSTWEQESELQDMYLNRKSFAFSADSPGTM
DQSRQIFESTLKTVDVTFQNLDSSEISLTDVSHYFDSDPTKVVASLRGDGKKPNAYIADT
TTANAQVRTLSETVRLDSRTKLLNPKWYEGMLSHGYEGVREISKRLVNTMGWSATAGAVD
NWVYEDTNATFIQDEQMRQRLMNLNPHSFRKVVSTLLEVNGRGYWQTSESNLQLLRELYQ
EVEDRIEGIE
NT seq 3993 nt NT seq  +upstreamnt  +downstreamnt
atgttcacccacgtcaagtccacgatcagacacgtcgctccggctgatctgcaagggcga
tcgctgatgcgtgtggtctatgtcgtgttagaagcccagtaccagagcgccttgaccgca
gcggtacgctccatcaatcaacacaatcccaacctggcgatcgaaatcagcggttattta
atcgaggaattgcgcgatcccgataactacgccgcctttcagcaggatgtcgcccaggcc
gatgtgtttatcgcttccctgattttcctggaggatctggcggataaggtggtcgaagct
gtggctccccaccgcgatcggttggatgtagctgtggtgttcccctccatgccccaggtg
atgcgcctgaacaagatgggtagcttctcaatggcgaatttagggcagtccaagagtgtg
atcgcccagttcatgaagaagcggaaggaaaaatctggggccggtttccaggatgccatg
ctgaagttgctgcggacgttgccccaggtgttgaaatacctgccgatggacaaagcccag
gatgcccgtaactttatgctcagcttccagtactggctggggggttcgccggaaaatctg
gaaaactttctgctaatgctggcggacaagtatgtctttaagggagaaaagggacaggcg
gcactgaccaactatcgcgaccccgtggcttacccggatatgggcatctggcatcccctt
gccccagaaatgtttgaagatgtgcgggaatacctcaactggtttaattcacgccgggat
atttctgctgacctcaaagatccgctagctcctaccgtcggactggtgttacagcgcacc
cacctggtcaccggggatgatgctcattacgtggccctggtgcaggaattagagtccgag
ggcgcacgggtgattccggtgttcgctggtggcttagacttttccaaacccgtcgaagcc
tatttctacgatccagcggcaattaaagagtccactgccctggtggatgtggtggtgtcc
ctgactggctttgctctggtgggtggcccggccaaacaggatcatcccaaggcgatcgcg
gccctgaaaaaactgaaccggccctacatggtggccctacccctggtgttccagaccaca
gaggaatgggaagacagtgatttaggcttacacccaattcaggtggccctccaaattgct
ctgccggaactggatggcgcgatcgaaccgattattctatctggccgcgatggcaccacg
ggtaaagcgatcgccctgcaggatcgggtagaaacgatcgcccagcgggccatgaaatgg
gcatccctgcgccgcaaaccgaaaattaccaagaaagtagcgatcacggtgttcagcttc
ccaccggataagggcaatgtcggaacagccgcctacctggatgtgtttggctcaatctat
aaagtgatggaagccctcaagcacaatggctatgacattgagaatctgccagagagtgct
gaagccctgatgcaggaagtaatccacgatgcccaggcccagtacagcagcccggaactg
aacattgcctacaagatgccggtgccggagtacgaaaccctgaccccctactcccgcaaa
ttggaagaatcctggggtaaaccaccgggccatctgaatagcgatgggcaacacctgctc
atttacgggaagcactacggcaatctgttcattggggtgcaacccacctttggctacgaa
ggcgatccgatgcggttgttgttctcccgttccgccagtccccaccacggctttgcggcc
tactacacctacctgaacaaaatctggaaagccgatgccgtactgcactttggcacccat
ggttcgctggaattcatgcccggtaagcagattggtatgtccggggattgctatcccgat
agcctgattggcaccattcccaacctctactactacgcggctaataacccctctgaagca
acgatcgctaaacggcgcagctatgccaatacgatcagctaccttaccccgccagccgaa
aatgccggtctctataaggggttgaaagaactgagcgagttgattgcctcttaccagacc
ctgaaagatagtggacggggcgtgccgatcgtcaacacgatcatggacaagtgccgcctg
gtgaatctggataaggatattaacctgcccgaaatcgatgccgccgaaatggaagcagcc
gatcgggatgccattgtgggccaggtctacatcaaactgatggagattgaatcccgctta
ctgccctgtggcctgcacgtgattgggaaaccccccagtgccgccgaggcgatcgccacc
ctggtcaatattgccagtctcgatcgggaggaagaaggaatcaaaggtttgcctcgcttg
ctggcggaaagtctgggtcgcgatctggaggaaatctatcagaacagcgatcgaggtatt
ttggcagatgtggagcggttgcagtcgatcaatcaggccactcgcgccgccgtcaccgct
ttagttgaaacccaggccgatgcggatgggcggatctcgcgagtctctaaactgaacttc
ttcaacatggggcgcaaagaaccctggattgaagccctgcaccaggccggttacccgaaa
gtagacagtgagcaactcaaacccctgatcgaatatctggagttctgcctcaagcagatt
gtggccgataacgagctgggtgctttactgcaagccctggaaggggaatacattctgccc
ggccccggtggagatccaatccgtaacccggatgtgctgcccacgggtaagaatatccat
gcccttgacccccagtccattcccaccgccgctgcggttaagtctgccaaagtggtggtc
gatcgattgattgcccggcagaaaattgaaaataacggagcctggccggaaacgatcgcc
ctcgtgctctggggaaccgataacatcaaaacctatggcgaatccctggcccaggtgatg
tggatggtgggtgtacgtcccctgccggattccttagggcgggtgaataagctggaattg
atcccgctggaagaactgggccgtccccgtgtggatgtggtggtgaactgctctggggtg
ttccgcgatctgtttgtcaaccagatggaactgctggataaggcgatcaaaatggccgcc
gaagccgatgagccgctggaaatgaactttgtccgcaaacacgccctcaagcaagcggaa
gacatggggattaacctgcgtcaggccgccacacgggtgtttaccaatgcctccggttcc
tatgcctcgaatgtcaacctggccgtggaaaatagcacctgggagcaggaaagcgaattg
caggacatgtacctgaatcgtaaatcctttgccttctccgccgattcccccggcaccatg
gatcagtcccgccagatttttgaatccaccctcaaaactgtggatgtgaccttccagaac
ctggattcttccgaaatcagcctcacggatgtcagccactactttgactctgacccaacc
aaagtggtagccagcttacggggggatggcaagaaacccaatgcttacattgccgatacc
accaccgccaatgctcaggttcgcaccctttccgaaaccgttcgtctggacagccgcacc
aaactgctgaacccgaaatggtatgaaggcatgctcagccacggctatgaaggtgtccgc
gaaatttccaagcgattggtcaacaccatgggctggtcagccaccgccggagccgttgat
aactgggtctacgaggatacgaatgccacgtttattcaggatgagcaaatgcggcaacgg
ctgatgaacctcaacccccactccttccgtaaggtggtcagcaccctgctggaagtgaat
gggcgcggttactggcaaaccagcgagtctaacctgcaactgctgcgggaactctaccag
gaagttgaagatcggatcgaagggatcgaatag

DBGET integrated database retrieval system