KEGG   Cyanothece sp. PCC 7425: Cyan7425_5014Help
Entry
Cyan7425_5014     CDS       T00836                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cyn  Cyanothece sp. PCC 7425
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cyn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Cyan7425_5014
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Cyan7425_5014
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Cyan7425_5014
Enzymes [BR:cyn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Cyan7425_5014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5104284..5105609)
Genome map
AA seq 441 aa AA seqDB search
MTQPSPTILSRDSLTTAATTATFRALKCKECGEEYELKAAHVCEFCFGPLEVVYDLEALR
RTVTRSTIAAGPNSIWRYRAFLPVATDTPIDVGTGMTPLLKSHRLARRLGLQNLYIKNDA
VNMPTLSFKDRVVSVALTRARELGFTTVSCASTGNLANSTAAIAAHAGLDCCVFIPADLE
AGKVLGTLIYAPTVMAVQGNYDQVNRLCSEVANTHGWGFVNINLRPYYSEGSKTLGYEVI
EQLGWELPDHIVAPLASGSLFTKIYKGFREFVEVGLVEDKAVRCSGAQAEGCSPIAQAFK
DGRDFISPVKPNTIAKSIAIGNPADAVYALDIARKTNGNIESVTDAEIVAGIQLLAETEG
IFTETAGGTTIAVLKKLVEAGKINPDEKTVVYITGNGLKTQEAVQGYVGEPLTIEPKLDA
FERALERSRTLDRLEWQPVLV
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgacccagccctctcccaccatcctcagccgtgattccctcaccaccgccgccaccact
gcgaccttccgcgccctcaagtgtaaggagtgtggcgaagagtatgaactgaaagcggcc
cacgtctgtgaattttgctttggtcccctggaagtggtttacgatctggaagctttgcgc
cggacggtcacccgctctacgatcgccgctgggccaaactcaatctggcgatatcgggct
tttctgccggtggcaacggacacgccgatcgatgtgggcacgggaatgactcctttactg
aaatcccaccgcttagcccgtcgcctggggttacagaacctctacatcaaaaatgatgcc
gtcaatatgcccaccctcagctttaaggatcgggttgtctccgtcgccctgaccagagca
cgggaattgggctttaccacggtgtcctgtgccagtacgggcaatttggccaactccacc
gctgcgatcgccgcccatgccgggttagattgctgtgtcttcattccggcggatctggaa
gcgggcaaggtgctgggaaccttgatttacgctcccacagtgatggcggtgcagggcaac
tacgatcaggtgaatcggctctgttcagaagtggcgaatacccacggctggggatttgtg
aatattaatctgcggccctactattcggaaggctccaaaaccctcggttatgaagtgatt
gagcaactgggttgggaactcccggatcacattgttgctcccctggcctctggttcgctg
tttaccaagatttacaaaggcttccgcgagtttgtcgaagtggggctggtggaagataaa
gccgtgcgttgcagtggggcccaggccgagggttgctcccccattgcccaggcgtttaag
gatggacgggactttatctcgccagtgaagccgaacacgatcgctaaatccattgccatc
ggtaaccccgctgatgccgtttatgccctggatattgcccgcaaaaccaacggcaacatt
gaatcggtcaccgatgctgaaattgtggctggcattcaactgctggcggaaacagaaggc
atctttactgaaaccgctggcgggacaacgatcgccgtgctgaagaaactggtagaagcc
ggtaagattaacccggacgaaaagacggtggtttacatcacggggaatggtttgaaaacc
caggaagccgtgcagggttatgtgggtgaaccgctgacgatcgaaccgaagttagatgcc
tttgaacgcgctctggaacgctcccgcaccctggatcggctggaatggcaacccgtgctg
gtctaa

DBGET integrated database retrieval system