KEGG   Cyanothece sp. PCC 7425: Cyan7425_5042Help
Entry
Cyan7425_5042     CDS       T00836                                 

Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
cyn  Cyanothece sp. PCC 7425
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cyn01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:cyn00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5133457..5134365
Genome map
AA seq 302 aa AA seqDB search
MQIRRRPNPVVAVQELRFQVKAPDATPRNILEEIVWHKEVEVEQMRERAPLLELRKQVQT
APPPRDFVAALRQAQYQPALIAEVKKASPSKGVLREEFDPVAIAQAYATAGAACLSVLTD
EKFFQGSFTYLNQIRQAVHLPLLCKEFIIYPYQMYLARSQGADAVLLIAAILSDQDLQYF
LKIATSLGMAALIEVHTLTELDRVLNLEGVSLVGINNRNLENFTVDLQTTCDLLSKRWDQ
LDQRNILVVSESGLYQAVDLQQVQTAGAKAVLIGESLVKKAADDRFSHETDRMQAKISAL
YS
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattcgtcgtcgtcccaatccggtcgttgcggttcaggaattgcgctttcaggtc
aaagcccccgatgccacaccccggaacattctggaagaaattgtctggcacaaggaagtg
gaagtggagcagatgcgggagagagctcctttgcttgaactgcgtaaacaggtgcaaaca
gccccccctccccgtgattttgttgccgctttacgacaagctcaataccaaccggccttg
attgcggaagtcaaaaaagcctctcccagtaaaggagttttgcgagaagagtttgatcca
gtggcgatcgcccaagcctatgcaaccgctggagcggcctgtttatcagtgttgacggac
gaaaagttttttcagggcagttttacctatctgaatcaaattcgtcaggctgtccatttg
cccctgctgtgtaaggaatttattatctatccctaccaaatgtacctggcccgcagtcag
ggggccgatgccgtgctgctgattgccgcaattctgtctgatcaggatctgcagtatttt
cttaaaattgccacgagtctgggcatggcggccctgattgaggtgcataccctgacagaa
ctggatcgggtgctgaatctagagggggtcagcctggtggggatcaacaaccgcaatctg
gaaaatttcacggttgatctacaaaccacctgtgacctgctgagcaaacgctgggatcag
ctcgatcaacgcaatattctggtggtgagtgaatcggggctctatcaggcggtggatctg
caacaagtccaaacggctggggccaaagcggttttaatcggtgaatccttagtcaaaaaa
gcggcagacgatcgcttcagccatgagacggatagaatgcaagccaaaatcagtgctctt
tacagttaa

DBGET integrated database retrieval system