KEGG   Cyanothece sp. PCC 7425: Cyan7425_5103Help
Entry
Cyan7425_5103     CDS       T00836                                 

Gene name
hisD
Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
cyn  Cyanothece sp. PCC 7425
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:cyn01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:cyn00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5193651..5194961)
Genome map
AA seq 436 aa AA seqDB search
MLRIITQQAEARTELRRICERTHDDQVVHKEATVREIIQTVKRQGDRALIHYTAEFDQIN
LAPEELRVTGAELDAAYQQVSKELLDAIRLARRQIEAFHRQRVPKSWVQFGEDEVVLGKR
YTPVDRAGLYVPGGRAAYPSTVLMNAIPALVAQVPRVVMVTPPGGEGQGVNPAVLVAAQE
AGVQEIYRVGGAQAIAALAFGTETIPKVDIITGPGNIYVTLAKKLVFGTVGIDSLAGPSE
VLVIADETANPAYVAVDLLAQAEHDPMAAAILITTSPTLAQQVVAEVKLQLQDHPRRLLT
EKAIAHYGLVIVVSSLEEAVALSNEFAPEHLELEVSEPWQLLEQIRHAGAIFLGTSTPEA
VGDYLAGPNHTLPTSGAARFASALGVETFLKSSSLIQYSPVALQKVANALQILAQTEGLP
SHRDSIRLRTQNLSQD
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgaattatcactcagcaggctgaagcacgaactgaacttcggcgaatttgtgag
cgtacccatgatgaccaggtggtgcataaggaggcaacagtacgggagatcatccagacg
gtcaagcgacagggcgatcgggctctgatccattacaccgcagagtttgaccagatcaac
ttggcgccagaagagttgcgggtgaccggggcggaactggatgcggcctaccaacaggtt
tctaaagaattactcgatgccattcgcctggcccgtcgtcagattgaagcttttcaccgc
caacgggtgccaaaaagctgggttcagtttggcgaagatgaggttgtgctgggtaaacgc
tatactcccgtcgatcgggctggtctgtatgtgccaggaggacgggcagcttaccccagt
acggtgctgatgaatgccattcctgcgctggttgcccaggtaccccgtgtggtgatggtt
acccctcccggtggcgaaggacagggggtgaatccagcggttctggttgcggctcaagaa
gctggggttcaggaaatttaccgggtggggggagcacaggcgatcgctgctctggctttt
gggacagaaacaattcccaaggttgacatcatcaccgggccaggaaatatatacgtcacc
ctggccaaaaaactggtctttggcaccgtggggattgactccctggccgggccctcagaa
gtcctggtgattgccgatgagacagccaatccagcctatgttgcggtggatctactggcc
caggcggaacacgaccccatggcagcggcaattttgattaccaccagtcccaccctggct
cagcaagttgtggctgaagtcaaactccaacttcaagatcacccccgtcggttgttaact
gaaaaagcgatcgcccactatggtttggtaattgtggtctcctctctggaagaagccgtt
gcactttccaatgagtttgccccggaacacctggaattggaagtcagtgagccctggcag
ttgctggaacaaatccgccatgctggagctatttttctgggaacctctactccagaggcg
gtgggagattatctggccgggccgaaccatacgttgcccacttctggagcagcccgcttt
gcctcagctttaggggtggaaacgtttctcaagtcctccagcctgattcagtattctcca
gtggccttgcaaaaagtggcaaatgccctccagatcctggctcagactgaagggctgccc
tctcaccgagattctattcgtctgcgaacgcagaacctttctcaggattga

DBGET integrated database retrieval system