KEGG   Cyanothece sp. PCC 7425: Cyan7425_5153Help
Entry
Cyan7425_5153     CDS       T00836                                 

Definition
hopanoid-associated sugar epimerase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
cyn  Cyanothece sp. PCC 7425
Brite
Enzymes [BR:cyn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     Cyan7425_5153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(5248208..5249236)
Genome map
AA seq 342 aa AA seqDB search
MATKVFVTGGTGFVGANLVRLLLERGYAVRALVRPQSDLANLSGLEVEIVQGDLTDANLS
EQLRGCQVLFHVAAHYSLWRSQRQALYDSNVLGTRRILAAARQAGIERTVYTSSVAAIGV
PPGGQIADETYQSPVEKLIGDYKKSKYLAEQEAHQAVAAGQDIVIVNPSTPIGPWDAKPT
PTGEIILRFLRREMPFYLDTGLNLIHVRDVVEGHLLALERGRTGDRYILGHQNLSLKDLL
QQLADLTGLPAPWGTLPVWIPLSVAWVDECLLAPLGKPPSVPLDGVQMAQQRMYYNPTKA
VRELGLPQTPIRTALQEAVDWFLQHGYVKSAVQSSSLPRPKR
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggccactaaggtatttgtcaccggaggaacgggatttgtcggggctaacctggtgcgc
ttattgctagagcggggctatgccgtccgcgccctggtgcgtcctcagagtgatctggcc
aatctcagtgggctggaggtggaaattgtccagggggatctgaccgacgctaatctgagt
gaacaactgcgtgggtgtcaggtgttgtttcatgtcgcagcccactacagtttgtggcga
tcgcaacggcaggctttatacgacagtaatgtactgggcacccgacgaattctggcggcg
gcccggcaggcggggattgagcgcaccgtttataccagttcagtggcggcgatcggcgtg
cctccggggggacaaattgccgatgaaacctatcagagtccggtggaaaagctgatcggg
gattacaaaaaatcgaaatatctggctgaacaggaagcccatcaggcagttgcggcggga
caggatattgtgattgtcaaccccagtacaccgatcggtccctgggatgccaagcccacg
ccaacaggagagatcattctgcgctttctccgccgggaaatgccgttctatctcgatacc
ggcttgaacctgatccatgtccgggatgtggtggaggggcacctgctggctttagaacga
ggacggacgggcgatcgctacattttggggcatcaaaacctcagcttaaaggatctgtta
cagcaattagctgacctgacgggactgccggccccttgggggacactgccagtctggatt
cccctcagcgtggcctgggtggatgaatgcctgctggctcccctgggtaaacctccttct
gtccccctggatggtgttcaaatggcccaacaacgcatgtactataacccaactaaagcg
gtcagagaactgggtctaccccaaactccgatcaggacggccctccaggaggcagtggac
tggtttctccagcacggttatgtgaagtcagctgttcaatcctcaagcttgccgcgtcca
aagcgctaa

DBGET integrated database retrieval system