KEGG   Cyanothece sp. PCC 8801: PCC8801_0117Help
Entry
PCC8801_0117      CDS       T00806                                 

Definition
delta-1-pyrroline-5-carboxylate dehydrogenase
Orthology
K13821  
proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
cyp  Cyanothece sp. PCC 8801
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:cyp00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cyp00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(120883..123858)
Genome map
AA seq 991 aa AA seqDB search
MVTQIDANSYENKTQSIARELITQTREKRSLWDKIGDQMRLDDKLMGWAMANPGLRVQLF
HFIDTLPALRSNAEIAHHLQQYLGVESVELPSALKGILNFTDYQSAPAQLAAATVSKSVE
TLAFKYIAGETVQQVIKAVEKLRKEKMAFSIDLLGEAVITESEAKAYFQKYLDLMEELSQ
QSQKWSKVPEIDEADGEALPKVQVSVKLTAFYSQFDPIDPEGSKDKVCAFIRVLLRRAQE
LGVAVHFDMEQYVYKDLTLSILKELLLEEEFLTRTDIGVTLQAYLRDSQQDLHDLIAWAK
QRGYPITIRLVKGAYWDQETIKASQNHWPQPVFNDKAATDINFEQMTQILLENHQYLYAA
IGSHNVRSQAKAIAIAQTLNVPRRAFEMQVLYGMGDQLAKALVKQGYRVRVYAPYGNLLP
GMAYLIRRLLENTANSSFLRQNLEERPVEELIAPPVIKGETEMKEAQKVTFVNAPDTDYS
REVLRERAQKALAKVKDSLGKTYLPLINGEYVQTDVIIDSVNPCNPSEIVGHIGLMSIEQ
AEQALNAAKAAFPAWKKTPATERAKILRKAADLMEERRHELSAWVCLEVGKILQQADAEV
SEAIDFCRYYAAEMERLDAGYSYDIAGETNRYQYQPRGIALVISPWNFPMAIATGMTVAA
LVAGNCTLLKPAETSSVIAAKMVEILVEAGIPKGVIQYVPGKGSQVGAYMVNHPDVHLIA
FTGSREVGCRIYADAAILQPGQKHLKRVIAEMGGKNAIIVDESCDLDQAVAGAVFSAFGY
SGQKCSAASRIIVLDPVYEAFLERFVEATRSLNIGPTDHPSTQVGPVIDATAQKRIQEYI
EIGKQQSTLALQMESPENGYFVGPTIFSNVSPSDTIAQEEIFGPVVAVIRVKNFDEALAV
ANGTDYALTGGLYSRSPEHIERAQNEFEVGNLYINRTITGAIVARQPFGGFKLSGVGSKA
GGPDYLLQFLEPRHITENIQRQGFAPIEGNE
NT seq 2976 nt NT seq  +upstreamnt  +downstreamnt
ttggtcacacaaattgatgcaaattcctacgaaaacaaaacccaatcaatagcgagggaa
ttaatcacccaaacccgcgaaaaacgctctttatgggataaaatcggcgatcaaatgcgc
ctggatgataaactcatgggatgggcaatggctaacccagggttaagggtacaattattc
cattttattgataccttacccgcattacgcagcaatgccgaaattgctcatcatttacag
caatatttaggagtagaatctgttgaattgccatcagcattaaaaggcattctgaacttt
actgactatcaatctgccccggcacaattagcagcagcaactgtcagtaaatcggttgaa
acattagcctttaaatatatcgcaggagagacggtacagcaggtcatcaaagcagttgag
aagctgcgaaaagaaaaaatggcttttagtattgacctactcggagaagcagttattacc
gaatctgaagccaaagcttactttcaaaagtacctcgacttgatggaagaattatcccaa
caaagtcagaaatggtcgaaggttccagaaatcgatgaagccgatggagaagccttacca
aaagttcaagtttctgtcaaattaacggcgttttattcccaatttgatcccatcgatcct
gaaggaagtaaagacaaagtttgtgcctttattcgagtattattgcgtcgtgcccaagaa
ttaggggttgctgtccattttgatatggagcaatatgtctataaagacctcactttatcg
attctaaaagaattactgttagaagaggaatttctgacgagaactgatattggggtcaca
ttacaagcttatttaagagactcccaacaggacttacatgatttaattgcttgggcaaaa
caacgaggttatcctattacaattagactggtaaaaggagcctattgggatcaagaaacc
attaaagcgagtcaaaatcattggccacaacctgtatttaacgataaagcagcaacagac
atcaattttgaacagatgactcagatattgctagaaaatcatcaatatttgtatgctgct
atcggttcccataacgtccgttcccaagctaaagcgatcgcgatcgcccaaaccctcaat
gtcccgcgtcgtgccttcgagatgcaggtactatatgggatgggggatcaactggcaaaa
gccttagtcaaacaaggctatcgcgtacgggtgtacgccccctacggcaacctcttaccc
ggaatggcctatctcatccgccgtttattggaaaatacggcaaatagttcatttttacgg
caaaacttggaagaaagacctgtagaagaactcattgcgcctcctgtcataaaaggagaa
actgagatgaaagaagcacaaaaagtcacttttgtcaatgcccctgacaccgattattcc
agggaagtcttacgggaaagagcccagaaagccctcgctaaagtcaaagattctctgggt
aaaacctatttacccctgattaacggcgaatacgtccaaaccgatgttattatcgactcc
gttaacccctgcaacccgtcggaaattgtcggacacatcggcttaatgtccattgaacag
gcggaacaagccctaaatgcagcaaaagcagcttttcccgcttggaaaaagacccctgct
accgaaagagcgaaaatcctgcggaaagcggctgatttgatggaagaacgccgtcatgaa
ctttccgcttgggtatgtctagaagtcgggaaaatcttgcaacaagcggatgcagaagtc
tccgaggcgatcgacttttgtcgttattatgccgccgaaatggaacggttagacgcagga
tatagctatgatatcgctggagaaaccaaccgctaccaatatcaacccagaggtattgct
ttggtgatctccccctggaatttccccatggcgatcgctacaggaatgactgtcgctgcg
ttagtagcaggaaattgtaccctactcaaacctgccgaaacatctagcgtcattgccgcc
aaaatggtcgaaattctggtagaagcgggtattcccaaaggcgttattcaatacgtcccc
ggaaagggttctcaagtcggtgcttatatggtcaaccatcctgacgtacatttgatcgcc
tttacgggatcgcgggaagtgggttgtcgcatctatgcagacgcagctattcttcaaccc
ggacaaaaacacctaaaacgggttattgccgaaatggggggcaaaaacgctattattgtc
gatgaaagttgcgatctcgatcaagcggtggcaggggcagtcttttccgcgtttggctat
tccggtcaaaaatgttcggctgcgtcgcgtattatcgtgttagaccccgtttacgaggca
tttctagaacggtttgttgaggccacgcgatcgctaaatatcggacccaccgatcacccc
tctacccaagtcggaccggttatcgatgccacggcgcaaaagcgtattcaggagtacatt
gaaatcggcaaacaacagtcaaccctagcgttacagatggagtctcccgaaaacggctat
tttgtcggccccaccatctttagtaatgtgtcaccatcggataccatcgcgcaagaggag
atttttggtcctgtggttgcagtaatacgggtgaaaaactttgatgaagcgttagcagta
gccaatgggacagactacgctttaactggggggttgtactctcgcagtcccgaacacatc
gaacgagcccaaaatgagtttgaagtaggcaacctgtacatcaatcgtaccattacaggg
gcgatcgtcgctcgtcaaccctttggcggtttcaagctgtctggggtggggtcaaaagca
gggggtcctgactatttgttacagttcctcgaacctcgtcatatcaccgaaaacattcag
cgtcaagggtttgcacccattgaaggcaatgagtaa

DBGET integrated database retrieval system