KEGG   Cyanothece sp. PCC 8801: PCC8801_0195Help
Entry
PCC8801_0195      CDS       T00806                                 

Gene name
gmk
Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
cyp  Cyanothece sp. PCC 8801
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:cyp00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(191954..192520)
Genome map
AA seq 188 aa AA seqDB search
MSSGKLIVLTGPSGVGKGTLVRSLLARHQNLYLSISATTRSPRGGEIDGQDYYFVSVPQF
EEMITQENLLEWANYAGNYYGTPRQKVEEKIDQGITVLLEIELVGARKIRETFPTAIRIF
ILPPSVEELERRLRGRGTEAEEAIARRLERAKEELAASSEFNYTVVNDELEKALEALEEL
IVNSFLHE
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcaggcaaacttattgtattgactgggcctagtggcgttgggaaagggacgctt
gttcgttccttactcgcacgccatcaaaatctgtatttatccatctccgctactacccgt
tctcctcgtgggggagaaattgacggtcaagattactattttgtcagtgtcccccaattt
gaggagatgatcactcaagagaacttactggaatgggctaattatgcgggcaattattat
ggcactccaaggcaaaaagttgaggagaaaattgaccaaggtattacggttttattagaa
attgaattagtgggggctcggaaaattcgagagacttttccaacggccatccgcattttt
attcttcctccctcggtagaggaattggaacgtcgtttgaggggtcgagggacagaggct
gaggaggcgatcgcccgtcgtttagaacgcgctaaagaagaattagccgcaagttcagaa
tttaattataccgttgttaatgatgagttagaaaaggcgttagaagcgttagaagagtta
atcgttaatagttttctccatgaataa

DBGET integrated database retrieval system