KEGG   Cyanothece sp. PCC 8801: PCC8801_0195Help
Entry
PCC8801_0195      CDS       T00806                                 

Definition
(GenBank) Guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
cyp  Cyanothece sp. PCC 8801
Pathway
cyp00230  Purine metabolism
cyp01100  Metabolic pathways
Module
cyp_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cyp00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PCC8801_0195
Enzymes [BR:cyp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     PCC8801_0195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_18 AAA_16 AAA_22 MMR_HSR1 RsgA_GTPase AAA_28 ABC_tran Apolipoprotein AAA AAA_24 NTPase_1 AAA_29 AAA_5 TsaE cobW ATPase_2 AAA_14 AAA_17 NACHT Cytidylate_kin AAA_30 AAA_25
Motif
Other DBs
NCBI-ProteinID: ACK64299
JGI: PCC88010195
UniProt: B7K1Z2
Position
complement(191954..192520)
Genome map
AA seq 188 aa AA seqDB search
MSSGKLIVLTGPSGVGKGTLVRSLLARHQNLYLSISATTRSPRGGEIDGQDYYFVSVPQF
EEMITQENLLEWANYAGNYYGTPRQKVEEKIDQGITVLLEIELVGARKIRETFPTAIRIF
ILPPSVEELERRLRGRGTEAEEAIARRLERAKEELAASSEFNYTVVNDELEKALEALEEL
IVNSFLHE
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcaggcaaacttattgtattgactgggcctagtggcgttgggaaagggacgctt
gttcgttccttactcgcacgccatcaaaatctgtatttatccatctccgctactacccgt
tctcctcgtgggggagaaattgacggtcaagattactattttgtcagtgtcccccaattt
gaggagatgatcactcaagagaacttactggaatgggctaattatgcgggcaattattat
ggcactccaaggcaaaaagttgaggagaaaattgaccaaggtattacggttttattagaa
attgaattagtgggggctcggaaaattcgagagacttttccaacggccatccgcattttt
attcttcctccctcggtagaggaattggaacgtcgtttgaggggtcgagggacagaggct
gaggaggcgatcgcccgtcgtttagaacgcgctaaagaagaattagccgcaagttcagaa
tttaattataccgttgttaatgatgagttagaaaaggcgttagaagcgttagaagagtta
atcgttaatagttttctccatgaataa

DBGET integrated database retrieval system