KEGG   Cyanothece sp. PCC 8801: PCC8801_0452Help
Entry
PCC8801_0452      CDS       T00806                                 

Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cyp  Cyanothece sp. PCC 8801
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:cyp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PCC8801_0452
Enzymes [BR:cyp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     PCC8801_0452
Exosome [BR:cyp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PCC8801_0452
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
460039..462387
Genome map
AA seq 782 aa AA seqDB search
MTTTISPEQVHQIVNNLHHDPFEVLGCHLLDNKSTPTQWVVRAYLPQATAAWVLCPTERQ
EYEMRSVHHPHFFECIIETPQLNNYQLRLKEGENERFIYDPYAFASPNLTDFDLHLFAEG
NHHRIYEKLGAHPDEVEGVKGVYFALWAPNARNVSILGDFNQWDGRLHQMRKRLNNVWEL
FIPEIGVGTCYKYEVKNWEGHIYQKSDPYGFYQEVRPNFGSIVTDLDTYQWHDADWMQKR
RQSQPLNDPISIYEVHLGSWLHASSEEKTSLLNGESDPVIVSEEWNTGARFLSYYELAHK
LIPYVKELGYTHLELLPIAEHPFDGSWGYQVTGYYAPTSRYGTPEDFMYFVDQCHQNGLG
VIIDWVPAHFPKDAHGLAYFDGTHLYEHADPRKGEHKEWGTLIFNYDRNEVRNFLVANVL
FWFDKYHIDGIRVDAVASMLYLDYARKEGEWIPNQYGGRENLEAADFLRQMNTILYSYFP
GVLSIAEESTDWPMVSWPTYAGGLGFNFKWNMGWMHDILDYFSMDPWFRQFHQNNVTFSM
WYHHNENFMLALSHDEVVHGKSSILGKMPGDEWQKYANVRALFTYMFAHPGKKTMFMGME
FGQWGEWNVWGDLEWNLLQYEPHQQLKQFFTELNALYQSEPAFYERDFEQEGFHWIDCND
TSHSVVSFIRRAKNPNDFIIAVCNFTPQPHSHYRIGVPEAGFYTELFNSDAKKYGGSNLG
NLGGKYTDEWTFHNLPYSVDLCLPPLAVLILKLNRTKLNSILTLDIHSSELEDDSLSLKP
NS
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaaccatttcccctgagcaagtccatcaaattgttaacaacctccatcatgat
ccctttgaagtgctaggttgtcatctcctcgataacaagagtactcccacccaatgggta
gtacgggcgtatttgccacaagctaccgccgcttgggtattgtgtcccaccgaacggcaa
gaatacgagatgcgatcggtacatcaccctcatttttttgaatgtattattgaaactcct
caactcaataactatcaattacgcctaaaagaaggagaaaatgagcgttttatttacgat
ccctatgcttttgcctctcctaatctaacagactttgatttacacttgtttgccgaaggg
aaccaccaccgcatttatgaaaaattgggggcacatccggacgaagtagaaggggtcaaa
ggggtttattttgctttatgggctcccaatgcgagaaatgtttcgattttgggggatttt
aatcagtgggatggtcgtctgcatcagatgcgaaaacgactgaacaatgtttgggaatta
ttcatcccagagattggtgtgggaacctgttataaatacgaggtcaagaactgggaaggt
catatttatcaaaaatccgatccatacgggttttatcaggaagttcgccctaattttggt
tcaattgtcaccgatctcgacacctaccaatggcatgacgctgactggatgcaaaagcgt
cgtcagagtcaacccctcaatgaccccatttccatttatgaagtccatctgggatcttgg
ttacacgcctcttcagaggaaaaaacctcgttactcaacggagaatctgatcccgtcatt
gtctccgaagaatggaacacaggagcccgttttttgagctattacgagttagcacacaag
ctcattccttacgttaaagagttaggctatacccatctagaattactgcccattgccgaa
caccccttcgacgggtcttggggatatcaagtcactggatattatgccccaacttcgcgt
tatggaactccagaagatttcatgtattttgtcgatcagtgccatcaaaatggactgggg
gtgattatcgactgggttcctgcccattttcctaaagatgcccacggattagcctatttt
gatgggacacacctctacgaacacgctgatccccgtaagggggaacataaggaatgggga
accttgatttttaactatgaccgcaacgaagtccgtaactttttagtggccaatgttctg
ttttggttcgataaatatcatattgatggcattcgagtcgatgctgttgcttcgatgctc
tatctcgattatgctcgcaaagagggagaatggattcccaatcaatacgggggtcgggaa
aacctagaggcggctgatttcctccgtcagatgaacacgatactgtacagttactttccg
ggggttctctccattgctgaagaatctaccgattggccgatggtttcctggccaacctat
gccggggggttagggttcaatttcaagtggaatatgggctggatgcacgatatccttgat
tatttcagcatggacccctggttccgtcaatttcaccaaaataacgtcacctttagtatg
tggtatcaccacaatgagaattttatgttagctctgtcccatgatgaagtggtacacggg
aagagtagtatactggggaaaatgccaggggatgaatggcaaaaatacgctaatgttaga
gccctatttacctatatgttcgctcatccgggtaaaaaaacgatgtttatgggcatggaa
tttggccagtggggtgaatggaatgtctggggcgatttagaatggaatcttttgcaatat
gaaccccatcaacaattaaagcagttttttactgaattgaatgctctttatcagagtgaa
ccagctttttatgaacgagattttgaacaagaagggtttcactggattgattgcaacgat
accagtcatagtgtagtctcgtttattcgacgggcgaaaaatcccaatgattttatcatt
gccgtttgtaattttacccctcaaccccacagtcactatcgcattggcgttcctgaagcg
ggattttataccgagttgtttaatagcgatgctaagaaatatggggggagtaatttaggc
aatttaggcggaaaatacaccgatgagtggacatttcataatcttccttattcagtagat
ttgtgtttaccccccttagcggtcttaattctgaagttaaatcgtacgaaattaaactca
attttaaccctggatattcactcttccgagttagaggatgattcattatccctaaagccg
aactcctaa

DBGET integrated database retrieval system