KEGG   Cyanothece sp. PCC 8801: PCC8801_0454Help
Entry
PCC8801_0454      CDS       T00806                                 

Definition
magnesium chelatase ATPase subunit I (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
cyp  Cyanothece sp. PCC 8801
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cyp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    PCC8801_0454
Enzymes [BR:cyp01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     PCC8801_0454
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
463964..465040
Genome map
AA seq 358 aa AA seqDB search
MTATLQAPPKTRRVVFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMGDRGTGKSTTIRAL
ADLLPEIEVVANDPFNSDPYDPDLMSDRVRQQLEDNISLQITTKKVTMVDLPLGATEDRV
CGTIDIEKALSEGVKAFEPGLLAKANRGILYVDEVNLLDDHLVDVLLDSAASGWNTVERE
GISIRHPARFVLVGSGNPEEGELRPQLLDRFGMHAEIHTVKEPALRVQIVEQRSEFDRDP
QKFCDNYQPEQEALQNKLVQAQEILKKATVDYDLRVKISEVCSELDVDGLRGDIVTNRAA
KALAAFEGRTEVTVDDIRRTIVLCLRHRLRKDPLETIDSGYKVTKAFNRVFGLEATEN
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgacagcaaccctacaagcccctccaaaaacccgtcgtgtcgtttttccctttacggct
attgttggccaagaagaaatgaaattggccttgctgctcaacgtcattgaccctaaaatc
ggtggtgtgatgattatgggcgatcgcgggacgggaaaatccaccactattcgtgcctta
gccgacttactgcctgaaatcgaagtcgtggctaacgatcccttcaactccgacccctat
gaccccgacttaatgagcgatcgcgtccgtcaacaactcgaagacaacatctccctacaa
atcaccaccaaaaaagtcaccatggtcgatctgcccctaggagcgacggaagatcgcgtc
tgtggtacgatcgatattgaaaaagccctttcagaaggggttaaagcctttgaacccgga
ttactcgctaaagctaaccggggcatcctctatgttgatgaggtcaacctattagacgat
cacctcgttgatgttctcctcgactcggctgctagtggatggaatacggtagaacgcgaa
ggaatctccattcgccatccagcgcgatttgtcttagtggggtcaggaaaccccgaagaa
ggggaattacgaccccaattactcgatcgctttggaatgcacgcagaaattcacaccgtt
aaagaaccggccttgcgagtgcaaattgtagaacagcgatcggagtttgaccgagatccc
caaaaattctgcgataactatcaaccagaacaggaagccttacaaaataagttggttcaa
gcccaagaaatactcaaaaaagcgacggttgactatgacttacgggtaaaaatttcggaa
gtctgctcagaattggatgtggacggactccggggcgatatcgttaccaaccgcgcagct
aaggcgttagcagcttttgaaggacgaaccgaagtaaccgtcgatgatattcgtcgtacc
attgtcctgtgtttgcgtcaccgactccgcaaagatcccctagaaaccattgactctggt
tacaaagtcactaaggcgtttaaccgagtatttggattagaggcgacagagaattga

DBGET integrated database retrieval system