KEGG   Cyanothece sp. PCC 8801: PCC8801_0526Help
Entry
PCC8801_0526      CDS       T00806                                 

Definition
ATP-grasp domain-containing protein
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
cyp  Cyanothece sp. PCC 8801
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cyp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PCC8801_0526
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PCC8801_0526
   00640 Propanoate metabolism
    PCC8801_0526
   00660 C5-Branched dibasic acid metabolism
    PCC8801_0526
Enzymes [BR:cyp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     PCC8801_0526
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(543371..544627)
Genome map
AA seq 418 aa AA seqDB search
MDLLEYQAKELFHRVGIPILPSQPIANLSEIKRLQIPYPVVLKSQVRSGGRGKAGGIRFV
ENTIDAIAAAQAIFSLPILGEYPEVILAEARYNTQAEFFLCVLFDYQLQCPVLLGSSQGG
IEVENLLSHIEKVVLDGEFSPFYARRLAIKMGLEGKLIHAVSSIIEKMYQLFREKDLDWI
EINPLAVSPTGEVMALDGKIAVNDSALPRHQDLLDLLTSQQSKASSMTLTSGKAEPWPPI
LQHLRSTSSKGEVGIISNSWGLALTTWDLLVKQKGKPDCAFVMLEKKPEKSIIEQFSLAL
AQAMQLTHLQVILINILGSPETAEAIAQAIADYYEPYSKQKNEDRLPRPTGANTSERQGR
RQNQTRSLSVTEPLPLVVRLVGGDIDAIKQHLSGLTIYWQEDLETAITQTLLSTSAKQ
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggacttactcgaataccaagctaaagaacttttccatcgtgtaggcattcccattttg
ccttcccaacccatagccaatctcagcgagatcaaacgtctccagattccctatcccgtc
gtattaaaatctcaagtccgttcggggggacgtggcaaagctggaggaattcgctttgtc
gaaaataccatcgatgcgatcgcagcagcccaagccatttttagtctaccgattttagga
gaatatcccgaagtaatcctcgcagaagctcgctacaacacccaagcggaattttttctc
tgtgttctgtttgattatcaactgcaatgtcccgtattactcggttcatcccaaggggga
attgaagtcgaaaacctcttaagtcacatcgaaaaagtggtcttagatggtgaattttcg
cctttttatgcccgtcggttagccattaagatgggactcgaaggtaaactcatccacgca
gtgagttcgattattgaaaaaatgtaccagctttttcgggaaaaagacctagattggata
gaaattaatcccctggccgtcagtcccaccggagaagtcatggcactcgatggtaaaatt
gccgtcaacgatagtgcccttcctcgtcatcaggacctcctagatctgttaacctcccaa
cagtctaaggcctctagtatgaccttaacctcaggaaaagccgaaccgtggccgcctatc
ctacaacatctacgatcaacctccagcaaaggagaagtcggcattattagtaatagttgg
ggactcgctttaaccacctgggatctcttagtgaagcagaagggaaaacccgattgtgct
tttgttatgctcgaaaaaaagcccgaaaaatctatcatagaacaattttccctagcctta
gctcaggcgatgcaattaacgcatttacaggttatcctaatcaatattttaggcagtcct
gaaaccgccgaggccatagcccaagcgatcgcagactattatgaaccgtactccaagcaa
aaaaatgaagatcgcttaccccgacccacaggagccaatacttccgaacgtcaaggtcgt
cgccaaaatcaaacccgttctctatcagtgactgaaccgttacccttggtggtgcgtctt
gtgggaggggatattgacgcaattaaacaacatctttctggtttaacgatttattggcag
gaagacttagaaacagcgataacccagacactattatcaacaagtgcgaaacaataa

DBGET integrated database retrieval system