KEGG   Cyanothece sp. PCC 8801: PCC8801_0574Help
Entry
PCC8801_0574      CDS       T00806                                 

Definition
phosphoribosylaminoimidazole carboxylase ATPase subunit (EC:4.1.1.21)
Orthology
K01589  
5-(carboxyamino)imidazole ribonucleotide synthase [EC:6.3.4.18]
Organism
cyp  Cyanothece sp. PCC 8801
Pathway
Purine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Inosine monophosphate biosynthesis, PRPP + glutamine => IMP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:cyp00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(605271..606443)
Genome map
AA seq 390 aa AA seqDB search
MDGMTIKRVGVIGGGQLAWMMDEAAQQLGIDLVIQTPSQDDPAVSIAAEVIFAPIADATA
TAQLATRCDVITFENEFIDLEALQKLEAKGVCFRPSLGVLAALLDKYEQRCYLKQIGVPV
PQCATLDSSSTPEFSFPLVLKTRRHGYDGQGTFIIQSLDELDSIFRRLEGVSLMIEEFVP
FERELAVMASRSVTGEIIVYPVVETYQQNQVCHWVIAPAAVSEAIKAEIEQIARHLLTQL
GVVGIFGIELFLTSQGQVLVNEIAPRTHNSGHYTLDACETSQFEMQLRAVAGLPLGSPKL
KALGTVMVNLLGYEQSHHDYKQKREQLAAIPGVHVHWYGKTESRPGRKLGHVTVLLGEIN
DSLTDEMLREQLLGTVKKIESIWYESDSRE
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggatggaatgacaattaaacgagtgggggtcattgggggcggacaattagcctggatg
atggatgaagcagcccaacagttaggcattgatttggtcatccaaaccccctctcaggac
gatcctgccgtgtctatcgctgcggaggtcatttttgcccctatcgctgatgcgactgct
acagcccaattagctacccgttgtgacgtgattaccttcgagaacgaatttattgacctc
gaagcgttacagaaattagaagccaaaggggtttgttttcgtcccagtttaggggtttta
gccgccctattggataaatacgaacaacgctgttatcttaaacaaattggcgtacctgtt
ccccaatgtgccaccctagacagttcatcaactccagaattttcctttcctttggtgctc
aaaacccgtcgtcatggttacgatggacaaggcacttttattattcaaagcttagatgag
ttagacagtatttttcgccgtttagaaggagtttctctaatgattgaggaatttgtgcct
tttgaacgcgaattagccgtgatggcatcccgtagcgtcacaggagagataattgtctat
cccgtggtggaaacctatcagcaaaaccaagtttgtcattgggtaatcgccccggctgct
gtttctgaagcaattaaggcagaaatcgagcaaatagcccgtcatttattaacccagtta
ggtgtagtgggtatttttgggatagaattatttttaacgtctcagggtcaggtattagtc
aacgaaattgccccacgcacccacaattcaggacactataccctagatgcctgtgaaact
tcccaatttgagatgcaattacgcgctgttgccgggttgcctttgggttcaccgaagtta
aaagcgttggggacagtgatggtcaatttattaggttatgaacaatcccatcacgattat
aaacagaagcgtgaacaactggcggcgattcctggggttcatgttcattggtatggtaaa
accgagtctcgtcctggccgaaaattaggtcatgtgaccgtattattaggagagattaat
gatagcttgactgatgaaatgttgagagaacagttattaggaacagtcaagaaaatagaa
tccatttggtatgagagtgattcaagggaatag

DBGET integrated database retrieval system