KEGG   Cyanothece sp. PCC 8801: PCC8801_0640Help
Entry
PCC8801_0640      CDS       T00806                                 

Definition
stearoyl-CoA 9-desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
cyp  Cyanothece sp. PCC 8801
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:cyp01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:cyp01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(667990..668814)
Genome map
AA seq 274 aa AA seqDB search
MTVATSQKLPLDWAIILYMATIHLVALLAFLPSNFSWGAVGVTLFLYWVTGALGITLGFH
RLVTHRSFQAPKWLEYFLVFCGTLACQGGPIQWVGLHRIHHKYSDTQNDPHNSNLGFWWS
HLGWMLHKIPADNDVPRYTQDIAEDPFYQFCQKYMILIQVALGLLLYVLGGWSFVIWGIF
VRLVMVFHFTWFVNSATHKFGYQSHESDDHSKNCWWVAVLTFGEGWHNNHHAYQYSARHG
LSWWEIDITWMTIQLLQFLGLATNVKLAPTEKTN
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgactgttgccacatctcaaaaactacccctcgactgggcgattattctttatatggct
actattcacctagtagcattactggcttttttgcctagtaatttcagttggggagcagtt
ggggttactcttttcctctattgggtaacgggagccctcggtattaccttaggattccat
cgcttggtcactcatcggagttttcaagcaccaaaatggctagaatacttcctggttttt
tgtggaactttagcctgtcaagggggtccaattcagtgggttggattacaccgaatccat
cataaatattctgatacacaaaacgatccccataattctaatttagggttttggtggagt
cacctgggatggatgctacataaaattccggcggacaatgatgtcccacgttatacccaa
gatattgcagaagatcccttttatcaattctgtcaaaaatatatgattttaatccaagta
gccttaggactattactctatgttttgggaggatggtcttttgttatttggggtattttt
gtccgtttagttatggtgtttcactttacttggtttgtcaatagtgctacccacaaattc
ggctatcaaagtcatgaatctgacgatcattccaagaattgttggtgggttgcggttctt
acctttggggaaggttggcataataatcaccatgcttatcaatactctgcccgtcatggg
ttatcttggtgggaaattgatattacttggatgaccattcaattattacaattccttggc
ttagccacgaatgttaaattagccccaaccgagaaaacgaattaa

DBGET integrated database retrieval system