KEGG   Cyanothece sp. PCC 8801: PCC8801_0832Help
Entry
PCC8801_0832      CDS       T00806                                 

Definition
2-isopropylmalate synthase
Orthology
K01649  
2-isopropylmalate synthase [EC:2.3.3.13]
Organism
cyp  Cyanothece sp. PCC 8801
Pathway
Valine, leucine and isoleucine biosynthesis
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:cyp00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    PCC8801_0832
   01230 Biosynthesis of amino acids
    PCC8801_0832
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PCC8801_0832
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    PCC8801_0832
Enzymes [BR:cyp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.13  2-isopropylmalate synthase
     PCC8801_0832
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
869516..871126
Genome map
AA seq 536 aa AA seqDB search
MSNQPDRIIIFDTTLRDGEQSPGASLTVEEKLTIARSLARLGVDIIEAGFPYASPGDFEA
VQKIAQTVGTEDGPRICGLARATQKDIQTAAEAVKPAAKGRIHTFLATSDIHLQYKLKKT
RQEVLAIVPDMVAYAKSLVDDVEFSPEDAGRSDPEFLYQVLERAIAAGATTINIPDTVGY
TTPSEFGALIGGIKQNVPNIDQAIISVHGHNDLGLAVANFLEAVKNGARQLECTINGIGE
RAGNAALEELVMALHVRRQYFNPFLGRPPESTEPLTNINTKEIYRTSRLVSQLTGMMVQP
NKAIVGKNAFAHESGIHQDGVLKNKLTYEIMDAESIGLTHNQIVLGKLSGRNAFRTRLKE
LGFELSDTEINNAFLRFKEVADKKKEITDWDLAAIVNDEMQQAPELFRLELVQVSCGDHA
CPTATVTLRTPDGQELTDAAIGTGPVDAVYKAINRVVQVPNELIEFSVKSVTAGIDAMGE
VTIRLRYEDKIYSGYAANTDIITASARAYISALNRLYGSIQDQSATEVTKSEVAAI
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgagtaatcaacctgatcggatcatcattttcgataccaccctaagagacggggaacag
tcccccggcgcaagtttaacggttgaagaaaaactgaccatcgctcgctcccttgcacga
ctgggagttgatatcattgaagcgggttttccctacgctagtccgggggactttgaagct
gtccaaaaaatcgcccaaaccgtcggcactgaagatggaccgagaatctgcggcttagct
agggcaacccaaaaagacattcaaaccgcagcagaagcggttaaacccgcagcgaaagga
cgcattcacacctttttggccacttctgacatccatttacagtacaaactcaagaaaacc
cgtcaagaagtcttagccatagtccctgatatggtggcctatgcgaaaagcttagtggat
gatgtggaattttctcccgaagatgccggacgcagtgaccccgaatttttgtaccaagtt
cttgaaagggcgatcgcggctggtgcaaccaccattaatatccccgatactgtcggttat
accacccctagcgaatttggcgcattaatcggcgggattaagcaaaacgtccccaatatt
gaccaagcgatcatctctgtccatggtcacaatgacctagggttagccgtcgctaatttc
ctcgaagcggtcaaaaacggagcccgacaactcgaatgtaccatcaatggcatcggagaa
cgggcaggtaatgcagccttagaagaattggtcatggccttgcacgttcgccgtcaatat
tttaaccccttcctcggtcgtccgcccgaatccacggaacccctaacgaatatcaatacc
aaggaaatttatcgcacctcccgtctagtctcccaactaaccgggatgatggtacaaccc
aataaagccattgtgggtaaaaatgcctttgcccatgagtccggcattcaccaagatggg
gtactcaaaaataagttaacctacgagattatggacgcagaatccatcggattaacccat
aatcagattgttttgggtaaactttcaggacgtaacgcttttcggactcggttgaaggaa
ttgggctttgaattgtccgatacggagattaataacgctttcttgcggtttaaagaagtc
gctgacaaaaagaaagaaatcaccgactgggacttagcagccattgtgaacgacgaaatg
cagcaagcccccgaattattccgtttagaattagtccaggtatcctgtggtgatcacgcc
tgtcctactgctaccgttaccttgagaacgcctgatggtcaagaattaaccgatgcagcc
attggaaccggtccggtggatgcagtttacaaagccatcaaccgcgtggttcaggttcct
aacgagttaattgaattttcggtgaagtctgttacggccggcattgatgccatgggagaa
gtgactattcgtctacgctatgaagacaaaatttactcaggctatgcagcgaataccgat
attatcacggcttcagcacgggcttatattagtgcgttgaatcgtctgtatggatcaatt
caagaccagtcagcaacagaagttactaagtcagaagtcgcggctatttag

DBGET integrated database retrieval system