KEGG   Cyanothece sp. PCC 8801: PCC8801_0912Help
Entry
PCC8801_0912      CDS       T00806                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cyp  Cyanothece sp. PCC 8801
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PCC8801_0912
Enzymes [BR:cyp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     PCC8801_0912
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
961061..961780
Genome map
AA seq 239 aa AA seqDB search
MTIASSNGFNRLNANGSNTLSPNLAERVSTRPDRNTHNGQPAQLHPISDSSKEKMMEAVR
TMLEALGEDPEREGLLKTPKRVAEAMAFLTEGYSQSLETLVNGAIFDEGHNEMVLVRDIN
FFSLCEHHMLPFMGRAHVAYIPNQKVVGLSKLARIVEMYSRRLQVQERLTRQIAEAVQEI
LDPRGVAVVMEASHMCMVMRGVQKPGSWTVTSAMLGVFQDEQKTREEFLNLIRHQPNFF
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgacaatagcttcttccaacggattcaatcgccttaatgctaacggttctaacaccctt
agtcccaatttagccgagcgagtatctacccgacccgatcgcaacacccacaatggacaa
ccggctcaactccatcccatctctgacagcagcaaagagaaaatgatggaagcggtgcgg
acgatgttagaagcgttaggagaagatcctgagcgagaaggactcctcaaaacccccaag
cgcgtcgccgaagcgatggcttttctcaccgagggatatagtcagtccttagaaacccta
gtcaatggcgcgatctttgatgaggggcacaatgagatggtcttagtccgcgatatcaac
ttctttagcctctgtgaacatcatatgttgccctttatgggacgggctcatgttgcctat
attcctaatcaaaaagtagtaggactaagtaaactagcgcggatcgtcgaaatgtattct
cgtcgcttacaggttcaagaacggttaacccgtcaaattgccgaagcggttcaagaaatt
ttagatccgcgaggcgttgctgtcgtgatggaagctagtcatatgtgtatggtgatgcgt
ggagtgcaaaaaccgggctcttggacagtcaccagtgccatgttaggggtatttcaggac
gaacaaaaaacccgtgaggaattcctaaatttaattcgtcatcaacctaactttttttag

DBGET integrated database retrieval system