KEGG   Cyanothece sp. PCC 8801: PCC8801_1146Help
Entry
PCC8801_1146      CDS       T00806                                 

Definition
Acireductone dioxygenase ARD
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
cyp  Cyanothece sp. PCC 8801
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyp00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    PCC8801_1146
Enzymes [BR:cyp01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     PCC8801_1146
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     PCC8801_1146
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1200375..1200923
Genome map
AA seq 182 aa AA seqDB search
MAILQLENGTTYIQLDDITRELAPLKVKLNYWTVGEDRKLGNLLDQESLSEEEKEDVLQR
LDHYFQQLKEKDGYQSRDLIVLHRNIPNLDDLLAKFERCHTHRDDEVRYIIDGEGVFGFV
RPDGSQVELTVQAQEYVNVPANTEHWFHLTATKRIKAVRYFTSTEGWTPEYTGTEIRFLT
KV
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atggccattttacaattagaaaacgggacaacttatatccaacttgacgatattactaga
gaactcgctcccttaaaggttaaacttaattattggacggtcggagaagacagaaaactt
ggtaatttgctagaccaagaaagtttaagtgaggaagaaaaagaagacgttttacaaagg
ttagatcactattttcaacaattaaaagaaaaggatggttatcagtcgagggacttaatt
gttcttcatcggaatattcctaatctagatgatcttttagctaaatttgaacgatgtcac
acccatcgggatgatgaagtgcgttatattattgatggtgagggcgtatttgggtttgtt
cgtcccgatggttctcaagttgaattaacggttcaagctcaagaatatgtcaatgttcct
gccaatactgaacactggtttcatctaaccgctacaaagcgcattaaagccgttcgttat
ttcacttcaaccgaaggatggactcctgaatatacagggacagaaattcgttttttaacc
aaagtctaa

DBGET integrated database retrieval system