KEGG   Cyanothece sp. PCC 8801: PCC8801_1396Help
Entry
PCC8801_1396      CDS       T00806                                 

Definition
Alpha,alpha-trehalase (EC:3.2.1.28)
Orthology
K01194  
alpha,alpha-trehalase [EC:3.2.1.28]
Organism
cyp  Cyanothece sp. PCC 8801
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PCC8801_1396
Enzymes [BR:cyp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.28  alpha,alpha-trehalase
     PCC8801_1396
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1459551..1461095
Genome map
AA seq 514 aa AA seqDB search
MLNSLPLYDELRLTSQDLAPIRHYIKHTWKTLTRSPRHIVKAARDPKLEYQGDQPLPVYL
SAREDYVQVENKLRQLLSPEELAQIELQVLPPEMNQIEHHGLLYLPGEYVVPGGRFNELY
GWDSYFIQLGLLQDGEIALAQSMIDQLLYEIEHYGTVLNGNRTYMLNRSQPPFLTRMILD
LYHRTHDLNWLRSVLPTVQSYYFYWTVPPHLNQATGLSHYNAFGVGPAPEVISSEIDENG
KNHYERILEYYRTHEIEDYDVSLYYDQETDSLTDLFYQGDRSMRESGFDPTNRFGPFSVD
IIHYAPVCLNSLLYQMELDLAEMQRILGYGHAASYWLNHAENRRHLMNQYLWDDEVGLYF
DYNFRTGCCRRYEFVTTFFPLWVGLASPEQAQRVALNLSTFETPGGLVTSTHFSGNQWDE
PFGWAPLHLIAVDGLRRYGYIEEAHRIACKFVNLVLQEFNKTGTIVEKYDVKKCSADVSD
EIFFGYSSNEIGFGWTNGVVLELLAMLERDGVIV
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgctcaattctcttcccctgtatgatgaattacggctaaccagccaagatcttgcaccc
atcagacactacatcaaacacacctggaaaaccctcactcgttccccacgtcatatcgtt
aaagctgccagagatcctaaactggagtatcaaggagatcaacccttacccgtttatctt
tcagcgagagaagattatgtacaagtagaaaacaagttgcgtcaactactcagtccagaa
gaattagcgcaaattgaactgcaagttttacccccagaaatgaaccaaattgaacaccat
ggactgctttacctcccaggggaatacgttgtgcctggaggacgctttaatgaactctat
ggatgggatagctactttattcaattgggattactccaggatggagaaattgctttagcc
caaagcatgatagaccaattactctacgaaatcgaacactatgggacagttttaaacggc
aatcgcacctatatgctcaaccgttctcaacctccctttctcacccgaatgattttagac
ctgtatcaccgtactcacgatctcaactggttgcgttcagtgttaccaacggtacaaagc
tattatttttactggacggttcccccgcacctcaatcaagccacaggattgtctcactat
aacgcctttggggtgggaccagccccagaggtgatcagttccgaaattgatgaaaacggc
aaaaatcactacgaacgcatcttagaatactaccgcactcatgaaattgaagactatgac
gtgagtctgtactatgatcaagaaacagacagtttaaccgaccttttttatcagggcgat
cgctccatgcgagaatcgggatttgaccccactaatcgctttggaccgtttagcgtagat
atcatccattatgcccccgtctgtctcaattccctactgtatcagatggaactggattta
gccgaaatgcaacgcatcttaggctatggtcacgcggcctcctattggctcaaccacgcc
gaaaaccgccgtcatttgatgaatcaatacctctgggatgacgaagtagggttgtatttt
gactacaattttcggactggttgctgtcgtcgctatgaatttgtgaccaccttcttcccc
ttgtgggttgggttagcctctcccgaacaagcgcaacgggttgccctgaatttatccacc
tttgaaacccctggcggcctcgtcaccagtacccacttttccggtaatcaatgggatgag
ccttttggttgggctcccttacacctgattgctgttgatgggttgcggcgttatggttat
attgaggaagcccaccgcattgcctgtaaatttgtcaatttagtccttcaagagtttaac
aaaaccggaaccattgtcgagaaatacgatgtcaaaaaatgctcggctgatgtctctgat
gaaattttcttcggttatagttccaatgaaattggctttggctggacgaatggggtcgtt
ttagagttattggcgatgttggaacgcgatggggtcatcgtgtag

DBGET integrated database retrieval system