KEGG   Cyanothece sp. PCC 8801: PCC8801_1439Help
Entry
PCC8801_1439      CDS       T00806                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
cyp  Cyanothece sp. PCC 8801
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cyp00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1510940..1511425
Genome map
AA seq 161 aa AA seqDB search
MVQSAIALGSNLGDSLSILNESLNLISQSPEIDLKAFSSWYRTVPIGPPQPNYLNGCAIL
ETNLSPEKLLQILLKIEQHFGRIRREKWGPRTLDLDLLLYNDLILETDHLQIPHPRMLDR
AFVLVPLVQIAPTWVHPVTQKTIIELLDGVDCSGVTLDLTP
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atggttcaatccgcgatcgctctagggagtaatttaggagactcccttagtattttaaat
gaaagtcttaacttgatttctcagtcccctgaaatagaccttaaagctttttcttcatgg
tatcgaacagttcctattggaccaccccaacccaactatcttaacgggtgtgccatcctt
gaaacgaatttatctcctgaaaaattattacaaattctcctaaaaatagagcagcacttt
ggacgaatacgacgcgaaaaatgggggccgcgaaccttagatttagatttgctattatat
aatgatttaattcttgagacagatcacctgcaaattccccatccccgaatgctagatagg
gcttttgttttagtccctttggtacaaattgccccgacttgggtacatccagtgactcaa
aaaacgatcattgaactccttgacggggtagactgttctggagtgacgcttgatctaacc
ccctaa

DBGET integrated database retrieval system