KEGG   Cyanothece sp. PCC 8801: PCC8801_1490Help
Entry
PCC8801_1490      CDS       T00806                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
cyp  Cyanothece sp. PCC 8801
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cyp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PCC8801_1490 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PCC8801_1490 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PCC8801_1490 (trpA)
Enzymes [BR:cyp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PCC8801_1490 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1567535..1568338
Genome map
AA seq 267 aa AA seqDB search
MTSVSDCFQSLRDRRQCALIPFITAGDPDLETTAKALRLLDASGADLIELGVPYSDPLAD
GPVIQAAATRALGRGVKLEDVLGVVKEVSPEIKAPIILFTYYNPIFYRGVEAFLQQVKAA
GVQGLVVPDLPLEEAESLLKPAHEVGIAVTLLVAPTSPIERIEAIARQSQGFIYLVSVTG
VTGMRSQVTSRVKELLTSLRSATDKPIGVGFGISKPEHALQVKNWGADAVIVGSAMVKRL
AEGTPEEGLKAIGAFCQDLKQALKEDQ
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgacctcagtttcggattgtttccaatctctgcgcgatcgcagacaatgcgccttgatt
ccctttattacggcgggtgatcctgatttagagacaaccgccaaagccctgcggttactg
gatgcgtcaggggcagatctgattgaattaggtgttccctattctgatcccttagctgat
ggtccggtgatccaagcggcggctactcgcgccttaggtaggggggtaaaattggaagat
gtcttaggggtggttaaggaggtttctcctgagattaaggctccaattattctatttact
tactacaatccgattttttatcgcggtgtggaagcctttttgcaacaggtgaaagcagca
ggagtccaaggcttagttgtccctgatttgcccctagaagaagccgagagcctcttaaaa
cccgcccatgaggtggggatagcagtgaccctcttggtagccccgacgagtccaatagaa
cgcatcgaagcgatcgctcgtcaatcccaaggatttatctacttagtgagtgttacgggg
gtcacggggatgcgatcgcaggtaactagtcgcgtcaaagaattgctgacgagtctgcgg
agtgccacggataaacccattggggtaggttttggtatttccaaaccggaacacgcccta
caggtcaaaaattggggtgcagacgcggtgattgtgggtagtgcgatggttaaacgctta
gcggaaggaacccccgaagaaggattgaaggctattggtgcattttgtcaggatttgaaa
caagcactcaaagaggatcaataa

DBGET integrated database retrieval system