KEGG   Cyanothece sp. PCC 8801: PCC8801_1543Help
Entry
PCC8801_1543      CDS       T00806                                 

Definition
glycoside hydrolase
Orthology
K11331  
cation efflux system protein involved in nickel and cobalt tolerance [EC:3.2.1.17]
Organism
cyp  Cyanothece sp. PCC 8801
Pathway
Two-component system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:cyp02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1619072..1619785
Genome map
AA seq 237 aa AA seqDB search
MIVHHSRRKRIGKRFRLRKPCHWISNLILIVALVWFAHNLQKNSQPSPYSSLITHLPELA
MSGGDPYIRALMLTISASESNHKNSYFLLYGGSHVHNLKQHPNQCLPIKIGPNKGKCSTA
AGRYQFLTSTWQEKAQKYHPNPHKTHGKIIYSFEPKYQDMVVYRWLKDHHQWDVDLLTLL
KEDRVEEVLTELSDVWTSLGGGIEDNLMTPHLPSLYRHFLAQQLKSQNSDRVSENLI
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgattgtccatcattctcgacgtaaacgtattggtaaaagatttaggctcagaaaacct
tgtcattggatttctaatttaatcctcattgttgctttagtttggttcgctcacaatctt
cagaaaaatagtcaaccatccccctattcatctttaataactcacttacctgaactagcc
atgtcaggaggtgatccctatattcgtgctttgatgttaactatttctgcgagtgaatct
aatcataaaaattcttattttctcttatacggtggtagtcatgtgcataatctcaaacaa
catcctaaccaatgcttaccgattaaaattggaccgaataaaggtaagtgttcaacggcc
gcaggacgctatcaatttttaacttctacttggcaagaaaaagctcaaaaatatcatcca
aatcctcataaaactcacggcaaaatcatctatagttttgaacctaaatatcaagatatg
gttgtttatcgctggctcaaagatcatcatcaatgggatgtggatttattaactttgctt
aaagaagacagagttgaagaagtattaactgaattatccgatgtttggacaagtttaggg
ggtggtattgaagataatttgatgactcctcatttacctagcctttatcgtcatttttta
gctcaacaactgaaatctcagaatagcgatcgagtctctgaaaatcttatttaa

DBGET integrated database retrieval system