KEGG   Cyanothece sp. PCC 8801: PCC8801_1543Help
Entry
PCC8801_1543      CDS       T00806                                 

Definition
glycoside hydrolase
Orthology
K11331  
cation efflux system protein involved in nickel and cobalt tolerance [EC:3.2.1.17]
Organism
cyp  Cyanothece sp. PCC 8801
Pathway
Two-component system
Brite
KEGG Orthology (KO) [BR:cyp00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PCC8801_1543
Enzymes [BR:cyp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     PCC8801_1543
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1619072..1619785
Genome map
AA seq 237 aa AA seqDB search
MIVHHSRRKRIGKRFRLRKPCHWISNLILIVALVWFAHNLQKNSQPSPYSSLITHLPELA
MSGGDPYIRALMLTISASESNHKNSYFLLYGGSHVHNLKQHPNQCLPIKIGPNKGKCSTA
AGRYQFLTSTWQEKAQKYHPNPHKTHGKIIYSFEPKYQDMVVYRWLKDHHQWDVDLLTLL
KEDRVEEVLTELSDVWTSLGGGIEDNLMTPHLPSLYRHFLAQQLKSQNSDRVSENLI
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgattgtccatcattctcgacgtaaacgtattggtaaaagatttaggctcagaaaacct
tgtcattggatttctaatttaatcctcattgttgctttagtttggttcgctcacaatctt
cagaaaaatagtcaaccatccccctattcatctttaataactcacttacctgaactagcc
atgtcaggaggtgatccctatattcgtgctttgatgttaactatttctgcgagtgaatct
aatcataaaaattcttattttctcttatacggtggtagtcatgtgcataatctcaaacaa
catcctaaccaatgcttaccgattaaaattggaccgaataaaggtaagtgttcaacggcc
gcaggacgctatcaatttttaacttctacttggcaagaaaaagctcaaaaatatcatcca
aatcctcataaaactcacggcaaaatcatctatagttttgaacctaaatatcaagatatg
gttgtttatcgctggctcaaagatcatcatcaatgggatgtggatttattaactttgctt
aaagaagacagagttgaagaagtattaactgaattatccgatgtttggacaagtttaggg
ggtggtattgaagataatttgatgactcctcatttacctagcctttatcgtcatttttta
gctcaacaactgaaatctcagaatagcgatcgagtctctgaaaatcttatttaa

DBGET integrated database retrieval system