KEGG   Cyanothece sp. PCC 8801: PCC8801_1690Help
Entry
PCC8801_1690      CDS       T00806                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cyp  Cyanothece sp. PCC 8801
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PCC8801_1690
Enzymes [BR:cyp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     PCC8801_1690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1775652..1777157)
Genome map
AA seq 501 aa AA seqDB search
MTSFQRTSGILLHPTSLPSRFGIGDLGEGAYRFIDFLAASGQTLWQILPLGPTGYGNSPY
LSYSSLAGNPLLISPDILQGEGLLTQDEINGIHGFPADYVDYDRVIQTKLPLLKKASDRF
QHLASPKLKEAFKTFCDRHAQWLDDYALYMSIHAANPEKAWNQWDKDIAERQPQAVQAYT
ERFSEDIFYHKFLQFEFFRQWQDVKKYANERNIRIFGDIPIYVAYDSVDVWANADMFCLN
EKTKEAALMAGVPPDYFSATGQLWGNPVYNWQKLQGTNFQWWIQRFKSTLEYVDIVRIDH
FRGFEAYWAVPEGEKTAMNGKWIKAPGRQFFERLKQELGQLPIVAEDLGVITPEVEALRD
DFGFPGMKILHFAFDSDRVNPFLPYNYVKNCVVYTGTHDNNTTVGWFEGRNQEEKRRVTD
YLGCVSHEGIHWSLIRLAMGSVADLAIFPLQDLLGLHQNGRMNTPGLAEGNWGWRYQSHV
LNQDLVNHLRFVTELYGRLVK
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgacatcttttcaacgaaccagtggaattttactgcatccaacctctttacccagtcgt
tttggcattggcgacttaggagaaggagcttatcgcttcattgatttcttagcggcaagt
ggtcaaaccctatggcaaattttaccccttggtccaacgggatacggcaattccccttat
ctgtcctattcttccttagctggtaatcccttactcattagtcccgatattttacaagga
gagggattactcacccaagacgaaatcaatggaatccatggatttccagcagattacgtc
gattatgaccgagtgattcaaaccaaattgcccctactcaaaaaagcgagtgacagattt
caacatctagcctcaccgaagctaaaagaagccttcaagacgttttgcgatcgccacgcc
caatggttagacgactacgcactctatatgtctatccatgcagctaacccggaaaaagct
tggaaccagtgggacaaagatatcgccgaacgccaacctcaagcggttcaagcttacacc
gaacggttcagcgaagatattttctatcataaattcctacaatttgaatttttccgtcaa
tggcaggatgtcaaaaaatacgccaatgaacgcaacatcaggatttttggcgatattcct
atctatgttgcctatgacagtgtggatgtttgggctaatgctgatatgttttgcctgaac
gaaaaaaccaaagaagcagctttgatggcaggcgttccccccgattattttagtgccaca
ggtcaactttgggggaatccagtctacaattggcaaaaactccaaggaactaacttccaa
tggtggattcaacggtttaaatcgaccctagaatatgtagacatcgttcgcatcgatcat
tttcggggatttgaagcctattgggcagttcccgaaggagaaaagactgcaatgaatgga
aaatggataaaagccccaggacgacaattctttgaacggcttaaacaagaattgggacaa
ttacccatcgtcgctgaagatttaggggtgattaccccagaagtggaagccctacgggat
gattttgggtttccaggcatgaaaatcttgcattttgcctttgatagcgatcgcgttaat
cctttcttgccttacaattacgttaaaaattgtgtggtttataccggaacccacgacaac
aatacgacagtgggatggtttgaaggacgcaatcaggaagaaaaacgcagagtcaccgat
tatttaggctgtgtttcccatgaaggtatccactggagtctcattcgcttagccatgggg
tcagtcgctgacctagctatctttcccctgcaagacctcttaggattgcatcagaacgga
cggatgaatactcctggactagctgagggtaactggggatggcgatatcagtcccatgtc
ttaaatcaagacttggttaaccatttacggtttgttaccgaactctacggtcgtctggtt
aagtaa

DBGET integrated database retrieval system