KEGG   Cyanothece sp. PCC 8801: PCC8801_1749Help
Entry
PCC8801_1749      CDS       T00806                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cyp  Cyanothece sp. PCC 8801
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cyp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PCC8801_1749
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PCC8801_1749
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PCC8801_1749
Enzymes [BR:cyp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     PCC8801_1749
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1831570..1832811
Genome map
AA seq 413 aa AA seqDB search
MTTTPISQKTTTQTEYPDALGRFGRYGGKYVPETLMPALSELETAYSRYKDDPDFQQELN
QLLRDYVGRPSPLYFAERLTTRYARPDGSGPQIYLKREDLNHTGAHKINNALGQVLLAKR
MGKQRIIAETGAGQHGVATATVCARFGLECVIYMGVHDMERQKLNVFRMKLLGATVQPVA
AGTGTLKDATSEAIRDWVTNVETTHYILGSVAGPHPYPMMVRDFHHVIGQETRRQSLEKW
GVLPDILLACIGGGSNAMGLFYEFVKDSTVRLIGVEAAGESIASGKHAATLTKGRPGVLH
GAMSYLLQDEEGQVIEAHSISAGLDYPGVGPEHSYLKDSGRAEYYSVTDAEAIAAFQRLS
QLEGIIPALETSHAIAYLETLCPQLDGSPRIIINCSGRGDKDVQTVAKYLGNE
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccacccctatttcccaaaaaaccactacacaaaccgaatatcccgacgcttta
ggacgttttggccgctatggaggaaagtacgtccccgaaaccctaatgccggccttaagt
gagctagaaaccgcctacagtcgctacaaagatgaccccgactttcaacaggaattaaac
caactattgcgggactatgtaggtcgtcccagtcccctgtactttgcagaacgcttaacc
acccgttatgcccgtcccgatggcagtggtccgcaaatttacctgaaacgggaagattta
aaccatacgggagcgcataaaatcaataacgccctcggacaagtcctattagctaaacgc
atgggcaaacagcgcattatcgcagaaacgggagcaggtcaacacggagtcgctacggca
acggtttgtgctcgttttggactagaatgcgtcatttatatgggtgttcatgacatggaa
cgccaaaaattaaacgtttttcgcatgaaactcctcggtgctactgttcaacccgttgca
gcaggaacaggaaccctgaaagatgccacttcagaagctatccgagactgggtaacgaat
gttgagacgacccattatatcctagggtctgtagcgggtccccatccctatcccatgatg
gttagagactttcatcacgttattgggcaagaaactcgccgtcaaagtctcgaaaaatgg
ggcgttttacccgatattctcctcgcttgtattggaggagggtcgaatgccatgggactg
ttttatgagtttgttaaagatagtactgttcgcttaattggggtagaagcagccggagaa
agcattgcttcaggaaaacacgctgctaccctgacaaaaggtcgtcctggggttttgcat
ggggcaatgagttatctcttgcaggatgaggaaggtcaggtcatcgaagcccattctatc
agtgccgggttagattatcctggggtgggacctgaacatagttaccttaaagatagtggc
cgcgcagaatattatagtgtgacggatgctgaagcaatcgcggcgtttcaacggttatcc
caattagaaggaattattcccgcgttagaaacctctcatgcgatcgcctatttagaaact
ctttgtccgcaattagacggaagtcctcgcattattattaattgttcgggacggggggat
aaagatgttcaaaccgtggcgaaatatttgggcaatgaataa

DBGET integrated database retrieval system