KEGG   Cyanothece sp. PCC 8801: PCC8801_1983Help
Entry
PCC8801_1983      CDS       T00806                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
cyp  Cyanothece sp. PCC 8801
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:cyp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PCC8801_1983
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    PCC8801_1983
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PCC8801_1983
Enzymes [BR:cyp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     PCC8801_1983
Exosome [BR:cyp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PCC8801_1983
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2059289..2061172)
Genome map
AA seq 627 aa AA seqDB search
MFPKNVTFFQSSLALSSVATGLLISVVTPVEAASITNTKNVIIMIGDGMGWEMARAAAIA
KQIDAGATGDTLADFYTSGVGTGLSFQTLENYGLVTTYGTTIAPGNGVFSTGNSALDNSN
PATGESNLRPGFTFDPTFNPGTTASGGAINPSSNAVGNLVGYDPVRGGVTPWDASYYGGP
VSPGFDPEYIKYSYPDSANTATTLYTGVKSYNNAIGVDIFEEALQSTLALSAEKGKSTGI
VSSVPVDHATPGAAAANVNRRNKYDDEFPNLDNILQQELRIYQPTVILGGGHPLSNGSLP
SGVEPPQDFTFITASTYQELSENPTDNIYGYTFLERGPDAAATLAATAASLDPNEGDRLL
GLYGARGQNGNLPVSSADGDYSTTGYNMFSLFPTGTPDWERPLLPGETDAEFIAREIDEN
PTLQQLTEAALDVLEDDPDGFWLMVEAGDIDWSAHDNNMDNLIGTMFDFDKTVQSVIDWI
ENNGGWEENLLIVTADHDHYLTLNDNFPELYRNAGGEGLTLPAPDPADAGHFWGSDPNVK
YGWGSHTNRPVPVYFQGNGSEYLLNAVGTGYSAYGQPVPGIPGLVDQVHIAQTQQAALAT
VPEPASILGLIGFGIAGGLLTRRKSID
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atgttccctaaaaacgtaacattttttcagtcttcccttgcactatcaagcgttgcaact
ggactattaatatctgttgtaactcctgtcgaagcagcttccattaccaacaccaaaaac
gtcattattatgatcggggatggaatgggatgggaaatggccagagcagcagccattgcc
aaacaaatcgacgcaggagcaacaggagacaccctcgctgatttttatacctctggtgtc
ggaacaggactaagctttcaaaccctagaaaattacggtctagtaaccacctacggaacc
accattgcccctggaaacggggtatttagtaccggtaactctgccttagacaattctaat
cccgccacaggagaaagcaacctacggcctggttttacctttgatcctacctttaaccca
ggaacaactgcatcaggaggcgcaatcaaccctagtagtaacgctgtgggtaacttagtc
ggttatgatcccgttcgaggaggtgtaactccttgggatgcttcctattacggaggtcca
gtctctcctggtttcgatccagaatacattaaatatagctatcccgattcggctaatacc
gccacaaccctttatacaggggttaaaagctacaataacgccattggggtcgatatcttt
gaagaagcccttcaatcaaccctagccctttcagcagaaaaaggcaaatcaacggggatc
gtcagttcggttccagtcgatcatgcgactcctggtgcagccgcagccaatgtcaatcgt
cgtaacaaatatgacgatgaatttcctaatttagacaatattttgcaacaggaattacgg
atttatcagccaacggtgatactagggggaggtcatcccttaagcaatggcagcttaccc
agtggagttgaacctccccaggattttacgtttattactgcaagtacctatcaggaactc
agtgagaatcccactgataatatctacggttacacctttttagagcgcggccccgatgca
gccgctaccctagcagcgacagcagcctcccttgatcccaatgaaggcgatcgcctcttg
ggactctacggtgcacgcggacaaaatggtaatttaccggtgagttccgccgatggggac
tacagtaccacgggatacaatatgtttagtctctttcccacaggtacacctgactgggaa
agacccctcttaccaggggaaaccgatgcggaatttattgccagagaaatcgatgaaaac
cccaccctacaacagttaaccgaagcagccttagatgtcttagaagacgaccccgatggg
ttctggttaatggttgaagccggggacatcgactggtctgcccatgataataatatggac
aatctcattggtacgatgtttgacttcgataaaacggttcaatcggtgattgattggatt
gaaaataacggcggttgggaagaaaacctgctaattgtcacggctgaccacgatcactat
ttaacccttaatgataacttccctgaactctatcgtaatgcagggggagaagggctaacc
cttcctgcacccgatccggctgatgcgggtcatttttggggttccgatcccaatgttaaa
tacggttggggaagccataccaatcgtccagttccggtgtatttccaaggaaacggctca
gaatatctgcttaatgccgttggtacaggctattctgcctatgggcaacccgttcctggt
atccccggattggttgatcaagttcatattgcccaaactcaacaagcagccctagcaacg
gttccagaacctgcctcaattttggggttaattggttttggtattgccggaggattgtta
actcgccgtaaatctattgattag

DBGET integrated database retrieval system