KEGG   Cyanothece sp. PCC 8801: PCC8801_2126Help
Entry
PCC8801_2126      CDS       T00806                                 

Definition
protein-arginine deiminase (EC:3.5.3.15)
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
cyp  Cyanothece sp. PCC 8801
Brite
Enzymes [BR:cyp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     PCC8801_2126
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2195929..2197947)
Genome map
AA seq 672 aa AA seqDB search
MSRRLDIRRIEGRTATRVSRTPRRTHEDVLVVGQPALISLEDLKPSEADLISFWVTGEVT
LTVSGQSEPLPLDTPLTLSELGESLELIARTYSEKLRDRWLEITFLDAQEKPQSIYELEL
TAIRVCLDVDADRDGVVEENSPYKNDWKWGKDGYGAILLVNSDQDNNGTDDVNFEDYRLN
GLLDIKDLSLMVVRKTGPGRLPSGCELRLSVSRSDSRRVRVFDELDGNRGYELIGPGKSQ
GYLRERDTEKNLFLAIEGLHYPDRDFDGVITVDLSLIQDRQEIYSDRVRFQVAPWIMTPH
TLSPKTVYVSRLESGSNAPMIEDIRQLVGLAQAQLEVVAPHVNRGDRWMQDEIEIGYCQS
PGHLMYVVLDSPRNRGLDEFPEEHLLGTDFGYVTRDTGEGGNTLDSFGNLEVSPPVTVKG
TTYPFGRILYGGNHPDAPEYNTQMMGVVRDFLIAQKIQAPVELFSDWLSVGHIDEFMTFV
PTPTPKGFKLLLASPSKCFSLLQDLQEKGQGDLLLREGKEISSRDAAISVSDILNDTKLR
KDNDRFQEYINWNRTILKAELGLEEGDIIDLPSLFEATRNGRAETFFPNMVNMLVLGKEL
GIPKPYGPQIDGQCQFEAYVKTQLDPLGLNCHFIDDWTSYFLGRGDIHCGTNTRRQPFTQ
PWWEISLVTNGN
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgagcagacgattagacattagacggattgagggacgaaccgctaccagagtctctcgt
acccccagacgaacccatgaagatgttcttgtggtcggtcaacctgccttgatttcccta
gaagacctaaaaccctccgaagctgatttaatcagtttttgggttacaggagaagtcacc
ttaacggtttcaggacagtcagaaccccttcccctagatactcctcttaccctaagcgaa
ctgggagagtccttagaactaattgctagaacctacagtgagaaattgcgcgatcgctgg
cttgaaatcacttttttagacgctcaagagaaaccccaatcgatttatgagctagaatta
actgccattcgagtttgtttggatgtagacgcggaccgagatggagtggttgaagaaaat
agtccctataaaaacgactggaaatggggcaaggatggctatggagctattttattagtt
aacagtgaccaggacaacaacggaactgatgacgtgaattttgaggattatcgcctcaat
ggactcttagacatcaaagatttaagtttaatggtagtgcgtaaaaccggacccggaaga
ctgccctctgggtgcgaattgcgtctatcggtgagtcgatccgattcgcgtcgggtacgg
gtgtttgatgagctcgacggaaatcggggttatgaattaattggtcccggaaaatcccaa
ggctatctacgggaacgggataccgaaaaaaacctctttttagcgattgaaggactccac
taccctgatcgggactttgatggggtaattaccgtggatctgtccttaattcaagatcgc
caggagatttacagcgatcgcgttcggtttcaagtagctccttggatcatgactccccat
accctatcccccaaaaccgtctatgtctcccgtctagaaagtggctctaatgctccgatg
atcgaagatatcagacaattagtcgggttagcccaagcgcaactcgaagtggttgctccc
catgttaatcgaggcgatcgctggatgcaagatgagatcgaaatcggctattgtcagtcc
cccggccatttgatgtatgtcgtactcgactccccccgcaaccgaggattagatgagttt
cccgaagaacacctattaggaaccgattttggctatgtcacccgtgatacaggggaagga
ggcaatacccttgattcttttggtaatctagaagtcagtcctcccgttaccgttaagggg
actacctatccctttggacggattttgtacggaggaaatcatcccgatgcccctgaatat
aatacccagatgatgggagtcgtgcgagattttctgattgcccaaaaaattcaagccccg
gttgagttattctcagattggttgagtgtcggtcatattgatgaatttatgacctttgtt
cctaccccaacacccaagggatttaaactgttgttagcgagtccgtctaaatgttttagc
cttctccaagacttgcaggaaaaaggacaaggcgatctcttactcagggaaggaaaagaa
atttctagccgcgatgcagccattagtgtttcggacattttaaatgacaccaaacttcgc
aaagataatgatcggtttcaggagtatattaactggaatcgcactattttaaaagcggaa
ttgggtcttgaggaaggggatattattgatttacccagtctgtttgaagctaccagaaat
ggtcgtgcagaaacgttttttcccaatatggtcaatatgcttgtgttaggaaaagagtta
ggcattcctaaaccctacggaccccaaattgacggacaatgccaatttgaagcctacgtt
aaaacacagttagaccccttgggattaaattgtcattttattgatgattggacttcctat
ttcttaggtcgtggagacattcattgcggaaccaatacccgtcgtcaaccgtttactcaa
ccttggtgggaaatatcattggtaactaatggcaattaa

DBGET integrated database retrieval system