KEGG   Cyanothece sp. PCC 8801: PCC8801_2201Help
Entry
PCC8801_2201      CDS       T00806                                 

Definition
hypothetical protein
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
cyp  Cyanothece sp. PCC 8801
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cyp00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    PCC8801_2201
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    PCC8801_2201
Enzymes [BR:cyp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     PCC8801_2201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2274476..2276893)
Genome map
AA seq 805 aa AA seqDB search
MKTLFSLPNIPPCAWKRPIGQGWDKPYTVRYASNLDDGPNHGMPLGGFGSGCIGRSPSGD
FNLWHLDGGEHVFRSIPSCQFSVFEQPEGEDAQVYALSTQPPEEGTLSRWSWYPPEKGTY
HALYPRSWYQYEGVFKSQLICEQFSPIIPNNYQETSYPIGIFEWTAHNPTDKPITLSIMV
TWQNIVGWFTNAIKSPEITVRDDGSPEYQYQPRWGDSTGNFNQWVQDNFRVGFILNRIQL
HDEIQEGEGQICIASVTNPSVEVFYLGKWNPKGDGSEVWDYFAMNGSLPDTEDETPAEPG
EQIAVAMAIRFTIRPGRTKKIPFILAWDFPVTEFAPGVQYYRRYTDFYGRNGKNGWAMVR
TALKHSDVWYERVEEWQSPILKREDLPDWFKMALFNELYLLTDGGTLWTAASENDPVGQF
GVLECLDYRWYESLDVRLYGSFGLMMLWPRLEKSVLEAFARAIPTHDDTPRIIGYNQAKA
IRKAKGATPHDLGAPNEHPWQKTNYTSYQDCNLWKDLGSDFVLQVYRDYLLTGSDDTDFL
WECWPAITETLDYLKTFDLDNDGIPENSGAPDQTFDDWKLQGISAYCGGLWIAALEAAIK
IAEILLKNVPTTEELQSRNNPESIKHYVKNHRDWLEQSRSIYHDTLWNGEYYKLDSQSGS
DVVMADQLCGQFYARLLNFPDVVETQYTESALNKVYEACFLKFQDGKYGAANGMKPDGTP
EDPNSTHPQEVWTGINFGLAAFLLQMGRKDAAFKLTEAVVKQVYENGLQFRTPEAITAVG
TFRASHYLRAMAIWGIYGILTHFRP
NT seq 2418 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacattattctctctccccaatattcccccttgcgcttggaaacgccctatcggt
caaggatgggataagccctataccgtccgttatgctagtaatttagacgatggaccgaac
cacggaatgccccttggtgggtttggttctggttgtattggacgttctcccagtggtgac
tttaacctgtggcatctggatgggggtgagcacgtttttcgcagcattccatcgtgtcag
tttagcgtctttgaacagccagaaggcgaagatgctcaagtctatgccctatctacccaa
cctcctgaagagggaaccctctcccgttggtcttggtatcccccggaaaaaggaacctat
cacgccctttatccccgcagttggtatcagtatgaaggggtgtttaaaagtcaattaatt
tgtgaacaattttctcccattatccccaataactatcaagaaaccagctatcctatcggc
atttttgaatggactgcccataaccccacggataaacccattaccctgagtattatggtg
acgtggcaaaatattgtggggtggtttacgaatgccattaaatcccctgaaattactgtt
agggatgatggcagtcctgaatatcaatatcaaccccgatggggagacagtaccggcaat
tttaatcagtgggttcaagataattttcgggtcggttttatccttaaccgtattcaactt
catgacgaaattcaagaaggagaaggacagatttgtatcgctagtgtcactaaccccagt
gtggaggttttttacttaggaaaatggaatcctaaaggcgatggttcagaggtttgggac
tattttgccatgaatggttccttaccggatacggaagatgaaaccccggcagaaccgggt
gaacaaattgcggttgcgatggccattcggtttactattcgtccagggagaaccaagaaa
attccctttattttagcctgggattttccggtaacagaatttgcgccaggggtgcaatat
tatcgccgctatactgatttttatggtcgcaatggtaagaatgggtgggcgatggtgaga
accgctttaaaacattctgatgtgtggtatgaacgggtcgaagaatggcagtctcctatt
ttgaaacgggaggacttacctgactggtttaagatggctttattcaatgaattataccta
ttaacagatgggggaaccctgtggacggctgcttcagaaaatgaccccgtaggacaattt
ggggtacttgaatgtttggactatcggtggtatgaaagtttagatgttcgcttgtatggt
tcctttgggttaatgatgctttggcctcgtttagaaaagtctgttttagaagcatttgct
agggcaattcctacccatgatgatacccctagaattattggatataaccaagcaaaagcc
atccgaaaagcgaaaggggcaactccccatgacttaggagcacccaatgaacatccttgg
caaaaaaccaattacactagctatcaagattgtaatttgtggaaagatttaggcagtgat
tttgtgctccaagtgtatcgagattatttattaaccgggtcagatgatacggattttttg
tgggaatgttggccagcgattactgaaaccttagactatttaaagacgtttgatttagat
aacgatggcattcccgaaaattcaggagccccggatcaaacctttgatgattggaaatta
caaggaattagtgcctattgtggtgggttgtggatagctgccttagaggcggcgattaaa
atagcagaaattctgctcaaaaatgtgccaactacggaagaattacagtcgagaaataat
cctgaatccatcaagcattatgtcaaaaatcatcgtgattggctagaacaatctcggtca
atttatcacgatacgttatggaatggagaatactacaaactcgatagtcaaagcggttct
gatgtggtgatggcggatcaattatgcggtcaattttacgcccgtttattgaatttcccc
gatgtcgttgaaactcagtatacagaatcagctttaaacaaggtttatgaggcgtgtttt
ttgaagtttcaagatggaaaatatggtgcagctaatgggatgaaacctgatggaactccc
gaagatcctaactcaacccatccccaagaagtttggacaggaattaactttggtttagcg
gcatttttattacaaatgggacgcaaagatgcagcttttaagttaaccgaagctgttgtt
aaacaagtctatgaaaatggcttacaatttcgcactcctgaagcgataacggctgtggga
accttccgtgctagtcattatttacgggcgatggctatttggggaatttatggcatttta
acccattttcgaccctaa

DBGET integrated database retrieval system