KEGG   Cyanothece sp. PCC 8801: PCC8801_2353Help
Entry
PCC8801_2353      CDS       T00806                                 

Definition
(GenBank) 1,4-alpha-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cyp  Cyanothece sp. PCC 8801
Pathway
cyp00500  Starch and sucrose metabolism
cyp01100  Metabolic pathways
cyp01110  Biosynthesis of secondary metabolites
Module
cyp_M00565  Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:cyp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PCC8801_2353
Enzymes [BR:cyp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     PCC8801_2353
Exosome [BR:cyp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PCC8801_2353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase AMPK1_CBM Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: ACK66366
JGI: PCC88012353
UniProt: B7K2H3
Position
2420305..2422284
Genome map
AA seq 659 aa AA seqDB search
MNNTEAHPNSLFSDFDLYLFGQGQHHKIYEKLGAHPVEFNGTKGVYFAVWAPSAHEVAVI
GDFNHWNRDTHLMKRIEGGNPGIWELFIPNIGVGEKYKFAIKNHHKETVEKTDPYGYQQE
VRPATASIVTDLSYTWDDQDWLEKRAQTNPQEQPVSVYEVHLGSWKHTSWDNQPKNGVPV
GVPYKDNARFLNYRELADELIPYVKEMGYTHIELLPVTEYPFDGSWGYQVVGYYAVTSRY
GTPQDFMYFVDQCHQQGLGVIIDWVPGHFPKDSHGLARFDFTALYEYEDPRKGEHLEWGT
LVFDYGRNEVRNFLMASAIFWFEMYHIDGIRVDAVSSMIYLNYQREPGQWVPNQYGGDDN
IEAVSFLRELNKTIFGYYPGILSIAEEATEWKDVSRPIEGGGLGFNFKWNMGWMNDTLKY
FLINPHDRSSYHNKLTFSLWYAFNENFMLALSHDEVVHGKGHLFQKMGGQGGISDWDRIA
NLRVLFAYMFTHPGKKTLFMGMEFGQTHEWRYNLDLEWFLLDSELHWKLKKLVQDLNTIY
RTEPALYTDDFTPNGFQWIDCHDAGRGMLSFIRKDKFTHEKIVVVCNFKDYDQYNYWLGV
PDHGNYIELINTDSHTYGGSGKGNLSPMHSKQWNTEHFHNALEITVPKFSAIMFKLKRD
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgaacaataccgaagcacatccaaatagcttgttcagtgatttcgacctgtatctattc
ggtcagggacagcatcacaagatttatgagaaattaggggcgcatcctgtcgaatttaat
ggaacaaaaggggtttactttgcggtttgggctcctagtgcccatgaggtcgctgttatt
ggcgatttcaaccactggaaccgagacacccacttaatgaaacgaattgaagggggaaac
ccagggatttgggaactttttatccccaatattggcgttggcgaaaaatacaaatttgct
attaaaaatcaccataaagaaacggtggaaaaaaccgacccctatggttatcaacaagaa
gtgcggccagcaacagcttcaattgtcaccgatttatcctatacttgggacgaccaagac
tggttagagaaaagagcccagactaacccccaagaacaacccgtttccgtctatgaagtc
catttaggctcatggaaacataccagttgggataatcaacctaaaaatggagttcccgtc
ggtgttccttacaaggataacgcccgttttctgaattatcgagaattagcggatgaatta
attccctacgtcaaagagatgggttatacccacatcgaactccttccggtaaccgagtac
ccctttgatgggtcttggggatatcaagtggtcggttattatgccgttacttcacggtat
gggactccacaagattttatgtattttgtggatcaatgccatcaacagggattaggagtc
attatcgactgggttcctgggcattttcccaaggatagccatgggttagctcgttttgat
tttaccgccctctatgagtatgaagatccccgtaagggagaacatttagaatggggaacc
ctcgtctttgactatggccgtaacgaggtacgcaatttcttaatggccagtgccattttt
tggtttgaaatgtatcatattgacgggattcgcgttgatgctgtctcttcgatgatctat
ttgaactatcagcgagaacccggccaatgggttcccaaccaatacggaggggatgataat
atcgaggcggtttccttcctgcgggaattgaacaagacgattttcggttattatccaggg
attctctccatcgcagaagaggccacggaatggaaagatgtctctcgtcccatcgaaggg
ggtggactgggatttaatttcaaatggaatatggggtggatgaacgataccctcaaatat
tttctgattaatccccacgatcgctctagttatcacaataaactaacctttagtttgtgg
tacgccttcaatgagaatttcatgctggcactctcccatgatgaagtcgtccatggtaaa
ggccatttattccaaaaaatgggcggtcaaggtggcattagtgattgggacagaattgct
aatttacgggtactctttgcctatatgttcacccatccaggcaagaaaaccctatttatg
ggtatggaatttggccagacccatgaatggcgttacaatctcgatcttgaatggttcttg
cttgattctgaactgcattggaaactgaaaaagttagttcaagatctcaatacgatttac
cgaacagaacctgccctttatacggatgattttacgcctaatggcttccaatggattgat
tgtcatgacgctggccgtggaatgctttcctttatccgtaaagacaagtttacccatgag
aagatcgtagtcgtttgtaactttaaggactatgaccaatataactattggttgggcgtt
cctgatcacggaaactacatcgaattaatcaatacagattctcatacctatggaggaagt
ggcaagggcaatttatcgcctatgcactctaaacaatggaatactgaacatttccacaat
gcgttagaaattacggttcctaaatttagtgcgattatgtttaaactcaaacgagattaa

DBGET integrated database retrieval system