KEGG   Cyanothece sp. PCC 8801: PCC8801_2557Help
Entry
PCC8801_2557      CDS       T00806                                 

Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase, type I
  KO
K00150  
glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
cyp  Cyanothece sp. PCC 8801
Pathway
Glycolysis / Gluconeogenesis
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Reductive pentose phosphate cycle (Calvin cycle)
Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:cyp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PCC8801_2557
   01230 Biosynthesis of amino acids
    PCC8801_2557
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PCC8801_2557
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    PCC8801_2557
Enzymes [BR:cyp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     PCC8801_2557
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2650293..2651306
Genome map
AA seq 337 aa AA seqDB search
MIRVAINGFGRIGRNFLRCWLGRENTQLELVGINDTSDPRTNAHLLRYDSMLGKLNADIS
ADENSITVNGKTIKCVSDRNPLNLPWQEWGVDLIIESTGVFVDDEGASKHIVAGAKKVLI
TAPGKGGNIGTYVVGVNDHEYDHDKYNIISNASCTTNCLAPVVKVIHENFGIIKGTMTTT
HSYTGDQRILDASHRDLRRARAAAVNIVPTSTGAAKAVALVIPEMKGKLNGIALRVPTPN
VSVVDLVAQVEKSTIAEQVNEVLKAAAEGPMKGIIEYNDLPLVSCDYRGTDSSSIVDASL
TMVMGGDMIKVIAWYDNEWGYSQRVVDLAEVVAKNWK
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
gtgattagagtagcgatcaacggattcggacgcattggacggaactttttacggtgctgg
ttaggacgcgaaaacacccagttagagttggtggggattaatgatacttccgatccgagg
actaacgcccacctattgagatacgattcgatgttgggcaaactcaatgcggacatcagt
gctgatgaaaattccattactgttaatggaaaaaccatcaaatgtgtgtccgatcgcaac
cccttaaatttaccttggcaagaatggggagtagacctgattatcgaatctactggggtc
tttgttgacgacgagggagcttctaagcatatcgtcgctggagcgaaaaaagtgctgatt
acggctcctggtaagggaggtaacattggaacttatgtggttggggtcaacgatcacgaa
tacgaccacgacaaatacaatattattagtaatgctagttgtaccactaactgtctagct
ccagtggttaaggtgattcatgaaaactttggcatcatcaaaggaaccatgaccactacc
cacagttatacaggggatcagcgcattcttgatgcgagtcaccgggatttacgtcgggct
cgtgcggctgcggttaatattgtacctacttctacgggtgctgctaaggcggttgcttta
gttatccctgaaatgaagggtaaactcaatggtattgctctgcgggttcccactcctaac
gtttctgtggtggatttagtcgctcaagttgaaaagagtaccattgctgaacaagttaat
gaagtgcttaaagctgccgcagaagggccgatgaaaggaattattgaatacaatgattta
cctttagtttcctgtgactaccgtggaacagattcttcttctatcgttgatgctagtctg
acgatggttatgggtggcgacatgattaaggtaattgcttggtacgacaacgagtggggt
tattctcaacgggttgtggacttagctgaagtggttgctaaaaactggaaataa

DBGET integrated database retrieval system