KEGG   Cyanothece sp. PCC 8801: PCC8801_3087Help
Entry
PCC8801_3087      CDS       T00806                                 

Definition
hypothetical protein
Orthology
K09803  
hypothetical protein
Organism
cyp  Cyanothece sp. PCC 8801
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3228445..3228723)
Genome map
AA seq 92 aa AA seqDB search
MRIEFEWDEQKRFSNLQKHGIDFVRACQIFENYTVDFEDNRYNYDEERFISIGETNGQIL
TVVYTYRGDVIRLISARKATKYEQTLYYSDNP
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
gtgaggatagagtttgaatgggatgaacaaaaacgcttttctaacttacaaaagcatggt
atagattttgttagagcttgtcaaatttttgaaaattatacagtagattttgaagataac
cgttataattatgatgaagagagatttatttctattggagaaactaacggacaaatttta
actgtcgtctatacctatcgaggtgacgtaattagattaattagtgcgcgtaaagcaacc
aaatatgaacaaaccctctattactcggacaacccttga

DBGET integrated database retrieval system