KEGG   Cyanothece sp. PCC 8801: PCC8801_3615Help
Entry
PCC8801_3615      CDS       T00806                                 

Definition
Triose-phosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cyp  Cyanothece sp. PCC 8801
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cyp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PCC8801_3615
   01230 Biosynthesis of amino acids
    PCC8801_3615
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PCC8801_3615
   00051 Fructose and mannose metabolism
    PCC8801_3615
   00562 Inositol phosphate metabolism
    PCC8801_3615
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    PCC8801_3615
Enzymes [BR:cyp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PCC8801_3615
Exosome [BR:cyp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PCC8801_3615
  Exosomal proteins of bladder cancer cells
   PCC8801_3615
  Exosomal proteins of melanoma cells
   PCC8801_3615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3769560..3770252)
Genome map
AA seq 230 aa AA seqDB search
MHKTQAEALEFLQVLKLELEEADETRGVVLCAPFTALGTMSKSLHGGLIRLGAQNIHWED
SGAYTGEIAGAMLTEIGVEYVVVGHSERRQYFGETDETANLRVIAAQRHGLTPILCVGET
KSQRDAGETETVIINQVKRGLVDVDQRNLVIAYEPIWAIGTGDTCEASEANRVIGLIREQ
LTNKAVTIQYGGSVKPDNIDEIMAQPEIDGALVGGASLDPVGFARIVNYR
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgcacaaaacacaggccgaagctctggagtttttgcaagtcttgaaattagagctagaa
gaagctgacgaaacgagaggagtggttctctgtgctccgtttactgccttgggaaccatg
tcaaaaagcttacatggtggcttaattcgtttgggagcccaaaatatccattgggaagat
agcggagcctacacaggagaaattgcgggggcgatgttgacagaaatcggggtagaatat
gtggtggttggccacagtgaacgtcgccagtatttcggagaaacggatgaaacagcgaat
ttacgggtgattgcagcgcaacgccatgggttaacccccattctctgtgtgggggaaacc
aagtctcaacgggatgccggggaaacagaaacagtgattattaatcaggttaagcgcggt
ttggtggatgtagaccagcgtaatttagtgatcgcttatgaacccatctgggcgatcggg
actggtgatacctgtgaagcctccgaagctaaccgagtcattggacttattcgagaacaa
ctgaccaataaagcggtaacaattcaatatggaggttccgtcaaacccgacaatattgat
gagattatggcacagccagagattgatggagctttggtgggtggagcgagtttagatcca
gtggggtttgctcgaattgtgaattatcgttaa

DBGET integrated database retrieval system